CAZyme Information: MGYG000001274_00053

Basic Information

• Species: Streptococcus sp902373455
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp902373455
• CAZyme ID: MGYG000001274_00053
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
744	MGYG000001274_2|CGC1	82829.84	4.8825

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001274	1392963	MAG	Italy	Europe

• Gene Location: Start: 12508; End: 14742 Strand: +

Full Sequence      

MNEHQEESEHSSAATSEKENRTVSQGTEATQPATSLDEESEIADYGPLPSKAQMQYHREE
LAAFIHFGMNTYYDREWGDGQEDPCYFYPEHLDTDQWIKTLKEAGFKRTIMVVKHHDGFL
LYPSKYTDHTIAKSGWKEGKGDVLAEVSASASKYDMDMGVYLSPWDAHSPLYHVDTEDQY
NEYYLNQLKEILEDPKYGNKGKFVEVWMDGARGDGAQKVTYTFDKWFDAIRKAQGDIAIF
SAEPTNVRWIGNEKGIAGDPVWHKVNPDKIRNNPSNSYLNHGDSEGKQYSVGEADVSIRS
GWFYHDNQEPKSLRELMDIYFKSVGRGTPLLLNIPPNQDGKFADADVARLKEFRQTLDQL
YSVDYAAGALVEADSTRRNAHYSASYLTDGDEKTSWAPADDAKTGSFVLDLGKEQYFDVV
ELKETIEKGQRISGFTIDVAVNGQWVPFGAGSTVGYRRLIKGQPVDSRYLRVSITDAQAT
PILNGVSVYKTPASIEETDGYPLGLAYHSDRTADRANSQWNEDGEGVRGTSMWTKEKGAS
VTYQFEGTKAYVVATVDPGHGEMDVYVDGQKLATVNTQSPSRKRSQKVYETPDLKAGAHT
LTLVNSKGDAIATEGIYALNNQEKGLFEFAQPTLAVKKGDPAQVVVKRKGGSKGSASLKL
ITEPGTGVHGKVYKDTNVTLEFADGETEKTVQVPTLDFAGKETDVYDFKVKLLHPDQGSL
VGFIPELTVQVMEEVVQQSKWKEA

Enzyme Prediction     

No EC number prediction in MGYG000001274_00053.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	50	357	2.6e-69	0.861271676300578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	8.94e-104	46	489	8	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
smart00812	Alpha_L_fucos	3.16e-28	43	353	9	326	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	3.34e-28	87	352	79	323	Alpha-L-fucosidase.
smart00237	Calx_beta	4.98e-10	625	713	2	90	Domains in Na-Ca exchangers and integrin-beta4. Domain in Na-Ca exchangers and integrin subunit beta4 (and some cyanobacterial proteins)
pfam00754	F5_F8_type_C	9.95e-09	375	476	5	114	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEE18999.1	0.0	1	743	67	809
VED68021.1	0.0	1	743	67	809
AYF93755.1	0.0	1	743	67	809
AGY39008.1	0.0	1	743	67	809
QXW96731.1	0.0	1	743	1	743

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ORG_A	2.71e-195	42	492	4	451	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6OR4_A	4.23e-194	42	492	4	451	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6ORF_A	4.39e-194	42	492	4	451	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORF_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6TR3_A	1.85e-116	48	536	27	544	Ruminococcusgnavus GH29 fucosidase E1_10125 in complex with fucose [[Ruminococcus] gnavus E1]
6TR4_A	2.84e-115	48	536	27	544	Ruminococcusgnavus GH29 fucosidase E1_10125 D221A mutant in complex with fucose [[Ruminococcus] gnavus E1],6TR4_B Ruminococcus gnavus GH29 fucosidase E1_10125 D221A mutant in complex with fucose [[Ruminococcus] gnavus E1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	3.00e-110	47	495	38	482	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	9.17e-109	47	489	36	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q99LJ1	6.00e-06	44	210	31	217	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001274_00053.