CAZyme Information: MGYG000001275_00501

Basic Information

• Species: CAG-485 sp900321585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900321585
• CAZyme ID: MGYG000001275_00501
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607	MGYG000001275_5|CGC1	68659.19	5.9752

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001275	2994513	MAG	Italy	Europe

• Gene Location: Start: 76956; End: 78779 Strand: +

Full Sequence      

MSAFMLAVSAYAERSVTIGDYVGDRINSCIENRVKCQNTALLVEPFRHLTEGTRWQTEFI
GKWMLGAIASYRYTDDKELLNKIKEAASDLMSTQREDGYIGNYKETDRLTNWDIWGRKYT
SLALLDYYNLTGDKKALKSVERLINGLMDELKTRNVDIAKTGLYRGMPSCSILEPVMYLY
QYTKKRKYLDFATEIVAAVEKPGSTRLVTKALENVPVAHRFDFPKKWWSYENGHKAYEMM
SCYVGLIEYGKAVGDGKYLEAALAAAQNILDTEINVAGSGAAFECWYGGKECQTVPAYHT
METCVTFTWMQLLDRLWQQTGDSKYADEFERTMYNALMASLRGDGKEISKYSPLEGRRQH
GEEQCGLPINCCNANGPRGFAMIPDFALRTRRDTLFVNLYMPLEAGLDVGKSKLNIKISN
DFPKTGNNKIEISRQGKDEVVLALRIPEWCEGKYCVSVDGRVIDRSPVKGYVTVPVEKGT
TAITADFHLAAKIERLNGMQALTRGPLVFARDNRYNDGDVDECGIVKEDEKGEVDMKFLS
DGNEFAWCTVEVPMILGTDLEDPENSAGRMVKFCDFGSAGNDWSRDGRYRVWIVAPIHAM
SQPYHKY

Enzyme Prediction     

No EC number prediction in MGYG000001275_00501.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	31	510	2.9e-51	0.9465648854961832

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	7.68e-56	52	510	52	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.00e-45	36	510	42	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG4225	YesR	0.002	112	275	34	177	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
cd04434	LanC_like	0.002	122	289	9	151	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	5.14e-250	16	607	27	620
CEP77739.1	1.16e-33	8	520	17	546
QUR48577.1	1.36e-30	76	516	112	555
BBK93301.1	1.83e-30	76	516	112	555
QIX65272.1	1.83e-30	76	516	112	555

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	2.73e-27	51	516	63	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
7EXU_A	4.55e-17	52	520	70	576	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
3WRE_A	5.91e-17	52	520	70	576	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	6.02e-17	52	520	70	576	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
3WRF_A	1.19e-14	52	520	70	576	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	3.24e-16	52	520	70	576	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.608154	0.390227	0.000474	0.000438	0.000344	0.000370

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001275_00501.