CAZyme Information: MGYG000001275_00536

Basic Information

• Species: CAG-485 sp900321585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900321585
• CAZyme ID: MGYG000001275_00536
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
510	MGYG000001275_6|CGC1	56834.87	4.78

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001275	2994513	MAG	Italy	Europe

• Gene Location: Start: 22947; End: 24479 Strand: +

Full Sequence      

MKTNHILSILMSLLLAAGFISCSDDKDKGLQPDPINFVLENDLLSFQKESASNWFRIKSA
VTPQIECSEDWVSLKLESLTASIHRLDVTVSENTGNDRTATVKIISGTETKTLTINQSSA
PRATVADITDWLGLGWNPGNHMDSYKNGVADELCDFDYPITQELFDKVKAAGFKTIRLPV
TWIGHIGPAPDYKIDDRLERVAEIVGYAEKAGLNIIVNIHHDGSGGYGFWLDFKPAVANV
AKNLEVEDQLRKVWTQIAERFVDTGHFLIFEAFNEIHDGDWGWGANLTDNGRQYELLNEW
LQIFVDAVRSTGGKNATRYLGIPGYAGGWELIEHLKLPKDPAVGRLLVSAHCYSPGKFCM
EFYDEGGNWTYLPEWGHTASEGKYPADDVDEHGLAQIFQGLKERFTDKNIPVYIGEFTCT
NRPAGRETEFRDYYLEYFCKAAHDCGLAPVFWDNNGPGLGAGQGGIFNRRTGEIIQNNAS
AIAVMVRAVSDKSPEYTLQSIYDRAPAKIE

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	159	455	7.1e-80	0.9637681159420289

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	5.44e-41	157	455	22	269	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.74e-22	135	421	54	325	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd14948	BACON	6.19e-11	37	118	2	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13004	BACON	9.04e-07	65	118	5	61	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD39312.1	9.92e-318	1	507	1	506
QCP73003.1	1.79e-316	1	507	1	506
ALJ60576.1	5.70e-149	2	506	3	511
QUT88430.1	4.29e-137	63	506	153	597
ADY35478.1	4.03e-136	84	506	170	591

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WQY_A	1.60e-125	124	489	23	382	ChainA, Cellulase [Phocaeicola salanitronis DSM 18170]
4YHE_A	4.72e-103	132	506	14	385	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHE_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
4YHG_A	3.75e-102	132	506	14	385	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHG_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
2JEP_A	1.28e-58	118	478	28	385	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
3NDY_A	2.43e-52	128	469	15	323	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O08342	1.48e-58	124	478	39	390	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P28621	3.49e-49	118	470	30	357	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P28623	5.73e-49	128	469	46	354	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
Q12647	1.79e-46	132	475	32	351	Endoglucanase B OS=Neocallimastix patriciarum OX=4758 GN=CELB PE=2 SV=1
P20847	3.39e-46	122	455	37	358	Endoglucanase 1 OS=Butyrivibrio fibrisolvens OX=831 GN=end1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000575	0.089120	0.910095	0.000072	0.000071	0.000062

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001275_00536.