CAZyme Information: MGYG000001275_01258

Basic Information

• Species: CAG-485 sp900321585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900321585
• CAZyme ID: MGYG000001275_01258
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781		86698.38	7.0104

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001275	2994513	MAG	Italy	Europe

• Gene Location: Start: 18413; End: 20758 Strand: -

Full Sequence      

MNLHSLYIAAITAGAGAAFAPLALNGADTVAEARGFSSDVILSTDAYRWQGDTIFQNEFK
AWAVSPEEIHSTYKGRPGYFMPVEQTWKRKNDLSSYPRLKSNNRLHEAIYNMGLDEMVNA
VEPDTTLRTGKEWAGVWTRDVSYSIILSMCYMQPEASMISLMKKVNPSGQIIQDTGSGGA
WPVSTDRMIWVVAAYEIYKATGDRQWLEKVYPIALRSIKKDMATILSPRGLIKGETSFID
WREQSYPKWMQTVDISQSEAMGTNVLYAAVLNACAQMADILGQRKEAARLKADADALTDA
INKYFWLDDKGYYGMYTYGRDHKIMNPRAETLGLALSILYDIAPAERQKSISTHNPHTPY
GPAIFYPQISDMPSYHNNALWPFVASYWTLAQAKAGNEAGTMEGIGSVFRPAALFATNKE
NFNLDNGDYYTELNSSNMLWSLAGNIAITTRVLFGIHFEKDGLLISPFVPKALEGTRTLD
NFNYRGATLNITVNGYGANVAKITVNGKEYAPGKTIPAKRLKGVCNIVVDMDCKPIPAMD
VNRQPNLKAPVTPQTWLTNNPALNGEGVPVNNYLEWNPIEYISKYQVLKNGMLVAETRET
SWPATEPGEWQVIGIDARGVHSFASEPRSNRPATIYQFKNEGTGMKSPELCNAPAEGVKG
YTGQGFVEIDRTTDPETINIKIPQSGMYTFALRYANGNGPVNTENKAAIRTLMLNGSKRG
TFVMPQRGVGNWDDWGMSNRIQVPLTAGTYTVGITYRPENENMNINTNHALLDQLVVEKA
K

Enzyme Prediction     

No EC number prediction in MGYG000001275_01258.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04083	CBM35_Lmo2446-like	2.23e-15	660	777	22	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
COG3408	GDB1	1.35e-12	189	492	343	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam17389	Bac_rhamnosid6H	1.72e-09	177	349	78	244	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
cd04082	CBM35_pectate_lyase-like	1.02e-08	660	755	21	109	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd04086	CBM35_mannanase-like	1.74e-08	659	754	20	104	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWG27199.1	7.79e-222	83	779	211	892
AYA38918.1	5.71e-218	87	775	236	910
AKQ46615.1	1.38e-216	86	781	227	906
QKG56937.1	2.16e-213	76	780	219	907
ARS34527.1	1.17e-210	87	781	223	900

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70873	3.49e-07	660	760	433	526	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 GN=cit PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.697530	0.295277	0.005041	0.000789	0.000479	0.000887

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001275_01258.