CAZyme Information: MGYG000001275_01395

Basic Information

• Species: CAG-485 sp900321585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900321585
• CAZyme ID: MGYG000001275_01395
• CAZy Family: PL8
• CAZyme Description: Chondroitinase-AC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
683		75720.31	6.8347

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001275	2994513	MAG	Italy	Europe

• Gene Location: Start: 36916; End: 38967 Strand: +

Full Sequence      

MRRLILSIITTFAVIHAAGATLDGVRDAIRAEYLSVPPSAQTPGWVATIGRDGRWPDIDY
SDDSRSLWQLEKHLDRLVDMALAYEQGPRKDKKTYRAVVNGLSHWFGAGYRNSNWWYGKI
GVPRRMLALAYILDNDLPSALRDSVDRSLSAIDSEDFPARPGGDRIQVLGNHAKVLVWRR
DYKDAASIFRKIENEARIAPLEEIMYDATGGPAVRNTRMPAGRGVQADMTFHHRGDRVNS
TLTYGMELPEFFSYWAALLRDTECRFDSTGINFVIDYYLDAVCRHLVAGRYAEPSIMNRE
IARPGEGVVSPRLAEKLLSVSDGYRSGELRHFADVQAGKAAHKASYAHHFWQSDYFVFSR
PEFQTAVRIHSERNANSEAAHNSEGIRNHFRGDGACMLSVAGREYADMAPVMDFRMIPGA
TTPMIPYEPLAAWGSVHILDNPTRFAGAVTDSLYGAVAFDFISPRSDLRARKAWFFFDQE
YLCMGSGISCTSPDSIVTTVEQCLSPDASMSRRGDWYFHAGSGYHIIDGQSYGSVTHRHG
AWNNCVANVEYADDQMDADVFSLAIPHGVAPAQASYAYAVVPGAQKPAGHSFRILANTPS
VQAVAGNDGSLIYIVFYEKGYVDTPAGRFGAGQPCMMMIRDGHLRVSDPARRHYLLRIST
PAGDREVLVPTNEKAGCSVDAVI

Enzyme Prediction     

No EC number prediction in MGYG000001275_01395.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	348	583	4.7e-53	0.9879518072289156

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	3.90e-78	43	649	39	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	1.27e-64	348	584	2	251	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	1.81e-09	46	306	37	289	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	2.59e-08	595	651	1	61	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKP52686.1	9.45e-119	25	652	44	682
QUT50612.1	3.04e-118	20	659	371	1021
AYN69482.1	5.91e-116	46	662	83	731
AEL27150.1	3.40e-115	8	652	28	683
SCD21938.1	2.37e-109	46	651	54	691

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CB8_A	1.01e-55	48	640	34	626	CHONDROITINASEAC LYASE FROM FLAVOBACTERIUM HEPARINUM [Pedobacter heparinus]
1HM2_A	1.37e-55	48	640	56	648	ACTIVESITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HM3_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-Oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus],1HMU_A ACTIVE SITE OF CHONDROITINASE AC LYASE REVEALED BY THE STRUCTURE OF ENZYME-OLIGOSACCHARIDE COMPLEXES AND MUTAGENESIS [Pedobacter heparinus],1HMW_A Active Site Of Chondroitinase Ac Lyase Revealed By The Structure Of Enzyme-oligosaccharide Complexes And Mutagenesis [Pedobacter heparinus]
2WCO_A	1.61e-20	309	658	364	720	Structuresof the Streptomyces coelicolor A3(2) Hyaluronan Lyase in Complex with Oligosaccharide Substrates and an Inhibitor [Streptomyces coelicolor A3(2)],2WDA_A The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase in Complex with Chondroitin sulphate [Streptomyces violaceoruber]
2X03_A	1.61e-20	309	658	364	720	TheX-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)],2X03_B The X-ray structure of the Streptomyces coelicolor A3 Chondroitin AC Lyase Y253A mutant [Streptomyces coelicolor A3(2)]
6F2P_A	4.35e-11	19	651	19	698	Structureof Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59288	7.52e-55	48	640	56	648	Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3) OX=485917 GN=cslA PE=1 SV=1
Q9AQS0	7.22e-08	354	604	397	674	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q8A2I1	1.98e-06	413	640	669	917	Chondroitin sulfate ABC exolyase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=chonabc PE=1 SV=1
C5G6D7	2.60e-06	413	640	669	917	Chondroitin sulfate ABC exolyase OS=Bacteroides thetaiotaomicron OX=818 GN=chonabc PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000549	0.998578	0.000199	0.000233	0.000210	0.000191

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001275_01395.