CAZyme Information: MGYG000001275_01524

Basic Information

• Species: CAG-485 sp900321585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900321585
• CAZyme ID: MGYG000001275_01524
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
627	MGYG000001275_25|CGC1	70368.63	5.195

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001275	2994513	MAG	Italy	Europe

• Gene Location: Start: 10087; End: 11970 Strand: +

Full Sequence      

MRQLLYILLLTGLTPAVAGGAPRQTCSAGSTSPEVEVRGYVGERIRACIDGRVKTQDVEE
LVEPFRHQTETWLWQSEFLGKWMLGAVASYEYTGDEELFRKVREAAEKLMATQLPDGYIG
NYAPEAHLSNWDIWGRKYTALALLAYHRISGDKRALDCCSRLIDHLISELEQTGTDIAAT
GSYFGMASCSVLEPVVMLYEATGEKRYLDFARDIVGNIEKEGRSQLVSKALGNVPVSRRS
PYPGTWWSYDNGQKAYEMMSCYEGLTELGRVLDNPQYLEATERTVASILADEINIAGSGA
AFECWYEGKRLQTVPAYHTMETCVTFTWMQLCSRLLRHTRNALYADEFERTMYNALMASM
KCDGSQISKYSPLEGRRQEGEEQCGIHINCCNANGPRAFALIPATAYQSEGDRIYVNLYL
DSDAGIRIGNNEVRLHTSTRYPVDGKVEIVVDPRRSGEFTVALRIPLWADSCAVTVNGEP
VEDIAKGGYAMLRRKWSKGDRISADFNIKTKVEEFDRHQALVHGPLVMARDSRYGDGDVD
ECAVIQCNEKGVVAATLTENPAGSFAWIEMDVPAVLGTDLEDPENKKGKIVKFCDFGSAG
NDWNPKERYRVWIPRTLHMMSEPYHKY

Enzyme Prediction     

No EC number prediction in MGYG000001275_01524.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	66	527	1.7e-62	0.9122137404580153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.23e-65	72	529	53	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.69e-64	62	529	51	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04791	LanC_SerThrkinase	1.39e-07	90	215	99	231	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
cd04434	LanC_like	2.38e-04	135	215	3	81	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
COG1331	YyaL	6.69e-04	77	302	361	580	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	5.87e-288	35	627	27	620
ABR45039.1	6.71e-45	97	544	112	563
AST55952.1	6.71e-45	97	544	112	563
QUT97168.1	6.71e-45	97	544	112	563
QKH99528.1	6.71e-45	97	544	112	563

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	3.76e-37	73	527	73	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	8.01e-35	73	527	73	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	8.51e-34	85	561	78	564	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	1.06e-24	81	532	105	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
6YQH_AAA	2.20e-19	321	529	337	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000269	0.999118	0.000147	0.000149	0.000138	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001275_01524.