CAZyme Information: MGYG000001276_00714

Basic Information

• Species: Eubacterium limosum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Eubacteriales; Eubacteriaceae; Eubacterium; Eubacterium limosum
• CAZyme ID: MGYG000001276_00714
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632	MGYG000001276_5|CGC1	72680.31	9.433

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001276	3903827	MAG	Italy	Europe

• Gene Location: Start: 26146; End: 28044 Strand: -

Full Sequence      

MKEQNKTRIKKTIFILTMAAMTIYFGWRILFTLPFRFGPLASAVGIILLITELTGAVETF
ELYRNYSRSALPELPVIPAADYPEVDVFIATHNESEELLYKTVNACKYMVYPDKNRVHIY
LCDDSDRPEIAALAEQMDIGYFGLRENQHAKAGNLNNAIFKTHSPLIATFDADMIPTHDF
LMRTVPYFFLDNGPVGFIQSPQSFYNADLFQYNLYSEEKLPNEQDYFFKEVNVNRNYANA
PIYAGSNTLISRQAVTEVGGIATDSITEDFATGIRIQAAGYRCYAIPTVLAHGLAPATLR
DLIGQRRRWGRGCIQTLRQSCWLRHMGLPLRTRLSYYSSFLYWWTFFRRFVYISAPILFT
LFRVVIVDCTVPELLIFSMPAYLLYGLSLRFLSGSMRSTRWSNIIDTALFPYLMFPIILE
TLGIREKKFSVTRKDAVTDSRNFTLALPHLFFILLSAFAIYQCYTVWMPASFVAALVVMY
WLILNTFILIMAVFFILGRKNSRKNVRFSSNIPVVVKTPYGRFSGHTLDISERGMGIALD
DGRILDQSLPLEVLVWTERYRASMDARVARVAENKEGALKYGISFTSMDAENKSQYFQIV
YDREPDFPTRLVKSSGLRDLGRNIMQRLRRRR

Enzyme Prediction     

No EC number prediction in MGYG000001276_00714.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	167	350	1.3e-26	0.9390862944162437

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	2.24e-92	83	317	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	1.29e-68	24	577	200	758	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	1.47e-47	27	467	1	411	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	5.39e-36	92	319	7	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
cd06437	CESA_CaSu_A2	5.45e-28	83	312	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALU14736.1	0.0	1	632	1	632
QCT70363.1	0.0	1	632	10	641
ARD67211.1	0.0	85	632	1	548
QJA08945.1	2.81e-205	1	627	1	644
ADL34255.1	1.38e-200	15	617	13	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.55e-60	15	577	204	771	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	3.71e-54	15	535	57	603	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	8.11e-54	15	535	69	615	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	8.18e-54	15	535	70	616	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58931	6.64e-63	15	629	90	721	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q8X5L7	2.91e-60	15	577	204	771	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P37653	7.47e-60	15	577	204	771	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q93IN2	3.49e-56	15	577	204	771	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
Q8Z291	6.49e-56	15	577	204	771	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000013	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	31
350	367
374	392
402	424
444	466
476	498