CAZyme Information: MGYG000001276_03708

Basic Information

• Species: Eubacterium limosum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Eubacteriales; Eubacteriaceae; Eubacterium; Eubacterium limosum
• CAZyme ID: MGYG000001276_03708
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
206		23281.35	5.1351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001276	3903827	MAG	Italy	Europe

• Gene Location: Start: 1702; End: 2322 Strand: -

Full Sequence      

MKKRRRARKKKRFRPLIWGIVVITGVLLLNCSFMAGRGNKNNDAAQEEVLSSAVVEYRPV
VAQYAAEYGIEEYTDYLLAVMQVESGGNHEDVMQSSESLGLPPNSLETEESINQGCRYFA
KLVRLAAEKGCDFNTVVQAYNFGDEFLDFVAENGGTYTVELAEEYARQKSGGEEVTYLNP
IALKANGGWRYKYGNMFYVQLVYQYI

Enzyme Prediction     

No EC number prediction in MGYG000001276_03708.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16891	CwlT-like	2.04e-69	57	206	1	150	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13702	Lysozyme_like	8.70e-69	51	205	1	164	Lysozyme-like.
cd16896	LT_Slt70-like	4.02e-05	55	143	2	105	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	0.003	75	141	2	79	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	0.004	40	143	122	240	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARD65926.1	5.10e-147	1	206	1	206
ALU15384.1	2.72e-142	1	206	1	206
ADO36311.1	2.95e-142	1	206	13	218
QCT73576.1	7.27e-119	34	206	1	173
QDW73932.1	2.41e-69	16	206	7	201

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	4.26e-64	35	206	6	178	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	3.88e-58	50	206	20	177	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34636	1.18e-26	49	169	47	168	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1
P96645	6.49e-24	50	206	53	192	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
Q99ZN9	3.19e-23	54	203	30	187	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1
Q5XC63	1.24e-22	54	203	30	187	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=pvaA PE=3 SV=1
Q8P120	1.24e-22	54	203	30	187	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002885	0.002055	0.995060	0.000005	0.000002	0.000001

TMHMM  Annotations     

start	end
13	35