CAZyme Information: MGYG000001277_00761

Basic Information

• Species: Bilophila sp902373525
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila sp902373525
• CAZyme ID: MGYG000001277_00761
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
622		68429.15	10.4234

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001277	3409168	MAG	Italy	Europe

• Gene Location: Start: 116; End: 1984 Strand: +

Full Sequence      

MIPGYGPGQLHEVSRVYRVVVPESMSPYDACGKRSGEVASSFRFRPCGLFGLLLLCVLLG
LAGCGPKNVTSKGPFVVQEPAKGYPVVSSSGQKTGTVYLPADDGRPLSKAEREAFLSEGE
LDRNLSQDELGDVLLHFKYLVHEDRYTVEKNIERAQFYMPFIYETLRSRGLPRELAYIAF
IESGFNPKATSSSGAAGMWQFISSTGKHYGMNQDWWLDERRDPYQSTRAAADYLSKLHGM
FNDWHLAITAYNAGEGKIQRGLAATGSKTFFELRRKNEQIYSTRDRLSDENKQYLPKFLA
VCKIARNLDKLGFTRMDLSRSPQVAEVRAKPGTDLMLFAKSMGMSWEEFAAHNPAYQRYV
SHPSRSTKIYVPRRMAGQAQAMLIKLPPAKTGTSYAGLRDYKIARGDTMVSISRKTGVPV
AELRRLNQVSEPLRAGRTLKIPGTNRTGVDARALAKASAPASKSVQVASVRRSDARAVPQ
QPVRSSASATHEVKKGDTMYSIAKRYGVTQEAILAANGMKNHNLNLGQQLRIPAGGTAVA
ENRTVAAPVRAVSAPAPQRAPSRSVAVAKESNKVVQYTVQSGDTLWAIARKFNVSPVELL
SLNNMNRNTALRPGDTVRVAVN

Enzyme Prediction     

No EC number prediction in MGYG000001277_00761.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	158	303	2.7e-28	0.8888888888888888
CBM50	491	533	6.5e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10783	mltD	1.71e-65	154	530	100	444	membrane-bound lytic murein transglycosylase D; Provisional
cd16894	MltD-like	4.31e-62	166	301	1	127	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	3.17e-33	161	273	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.85e-18	178	263	7	90	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK06347	PRK06347	3.34e-18	401	620	333	524	1,4-beta-N-acetylmuramoylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGC49455.1	7.47e-166	52	622	24	555
CAJ54111.1	7.47e-166	52	622	24	555
ADP85240.1	1.50e-151	49	619	18	584
ABM29931.1	1.50e-151	49	619	18	584
AAS94525.1	1.50e-151	49	619	18	584

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UZ2_A	8.40e-07	489	533	3	47	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	6.25e-06	487	533	1	47	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ8	2.86e-38	154	532	97	442	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P0AEZ7	2.86e-38	154	532	97	442	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P32820	1.00e-17	154	268	21	136	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
Q49UX4	5.64e-12	389	620	17	194	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q6GC24	1.09e-10	401	622	29	204	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.857911	0.092693	0.049323	0.000023	0.000045	0.000007

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001277_00761.