CAZyme Information: MGYG000001277_02578

Basic Information

• Species: Bilophila sp902373525
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Bilophila; Bilophila sp902373525
• CAZyme ID: MGYG000001277_02578
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		41083.22	9.559

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001277	3409168	MAG	Italy	Europe

• Gene Location: Start: 60; End: 1178 Strand: -

Full Sequence      

MKNIWINAGELSGDMQAAALLTALREREPDIAAVGMGGPHLALAGQKNLFRVESLSVMGI
AEVFTALPRALRMLGEIKRELARLRPDAVVLVDAPEFNFRVAKIAHGLGIPVYYFIPPKI
WAWRTGRVRFLQQYVKRLFCILPFEPAFYAKHGVAVDYVGNPLVDMVNWPEVSKLSPVPG
RIGLMPGSRRKEVEALLPAFGKAARILLDQGRDLSFHCLRAPNMPEEKLRALWPADVPVT
FDAPENRYAAMRSCMCMLAASGTATLETALAGVPTVVSYRVAPLSALVGRWLIKVKWVSL
TNLIMGRELFPELLQEHATGEAMAAQLAAWLDVPAQLESVRSRLDELRRRCGEPGSAARA
AENLLEAMKKNE

Enzyme Prediction     

No EC number prediction in MGYG000001277_02578.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	349	3.1e-111	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.78e-116	1	372	1	379	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.97e-114	1	366	1	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.00e-88	4	361	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.11e-73	4	366	8	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.18e-50	1	323	1	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAS95839.1	4.26e-162	3	368	4	369
ABM28724.1	4.26e-162	3	368	4	369
ADP86417.1	4.26e-162	3	368	4	369
CAJ55109.1	1.18e-148	1	366	1	366
AGC50489.1	1.18e-148	1	366	1	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	7.94e-49	8	366	13	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.56e-48	8	366	13	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	3.43e-78	4	368	7	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q6ALW0	9.28e-76	2	365	10	383	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q2LVL8	1.06e-73	2	372	4	382	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	1.09e-73	2	370	7	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q1INL4	2.27e-72	1	372	1	382	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001277_02578.