CAZyme Information: MGYG000001279_01355

Basic Information

• Species: Pseudomonas_E fulva
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E fulva
• CAZyme ID: MGYG000001279_01355
• CAZy Family: GT26
• CAZyme Description: UDP-N-acetyl-D-mannosaminuronic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252	MGYG000001279_81|CGC1	27661.23	8.9042

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001279	4682858	MAG	Italy	Europe

• Gene Location: Start: 7935; End: 8693 Strand: -

Full Sequence      

MAGEQWRARWQAVIDQLQVIQDDEAAERLLQGLAAPVAPTVLGFVNAHAMNLIVSDDAYG
EALLGADVLLRDGSGMAMLYRQLGLAPGLNMNGTDFIPRLVHAYGGRRVAFWGTRQPFLE
QAVQCCVATYGVTPVSVHDGFADVPTYLRLATKHRPDLIVLGMGMPKQEAVAAALKRTGL
ACTIVCGGAVLDFMGGKVHRAPAWIRRLGAEWLYRLLCEPRRLFMRYVVGNPLFLLRARR
FAQAERAPHPGD

Enzyme Prediction     

No EC number prediction in MGYG000001279_01355.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT26	63	226	9.5e-42	0.9883040935672515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06533	Glyco_transf_WecG_TagA	3.55e-46	63	227	1	171	The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins. E. coli WecG is believed to be a UDP-N-acetyl-D-mannosaminuronic acid transferase, and is involved in enterobacterial common antigen (eca) synthesis. B. subtilis TagA plays a key role in the Wall Teichoic Acid (WTA) biosynthetic pathway, catalyzing the transfer of N-acetylmannosamine to the C4 hydroxyl of a membrane-anchored N-acetylglucosaminyl diphospholipid to make ManNAc-beta-(1,4)-GlcNAc-pp-undecaprenyl. This is the first committed step in this pathway. Also included in this group is Xanthomonas campestris pv. campestris GumM, a glycosyltransferase participating in the biosynthesis of the exopolysaccharide xanthan.
pfam03808	Glyco_tran_WecB	6.81e-45	66	227	1	169	Glycosyl transferase WecB/TagA/CpsF family.
COG1922	WecG	9.07e-39	22	238	21	244	UDP-N-acetyl-D-mannosaminuronic acid transferase, WecB/TagA/CpsF family [Cell wall/membrane/envelope biogenesis].
TIGR00696	wecG_tagA_cpsF	5.73e-19	61	232	1	177	bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family. The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in enterobacterial common antigen (eca) synthesis in Escherichia coli. Another family member, the Bacillus subtilis TagA protein, is involved in the biosynthesis of the cell wall polymer poly(glycerol phosphate). The third family member, CpsF, CMP-N-acetylneuraminic acid synthetase has a role in the capsular polysaccharide biosynthesis pathway. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK03692	PRK03692	1.45e-08	158	228	160	235	putative UDP-N-acetyl-D-mannosaminuronic acid transferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDC04610.1	2.94e-187	1	252	1	252
QPH51124.1	2.94e-187	1	252	1	252
QPH46036.1	2.94e-187	1	252	1	252
AVF55528.1	6.93e-186	1	252	1	252
CRN08410.1	2.82e-185	1	251	1	251

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MPK_A	1.11e-10	14	222	11	221	ChainA, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7MPK_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_A Chain A, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_B Chain B, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9],7N41_C Chain C, N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase [Thermoanaerobacter italicus Ab9]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27620	5.07e-13	41	222	35	220	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagA PE=1 SV=1
Q8RKI7	1.32e-12	59	249	53	245	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarA PE=3 SV=1
Q7A714	2.17e-11	46	223	49	230	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Staphylococcus aureus (strain N315) OX=158879 GN=tarA PE=1 SV=1
Q6GBJ4	2.17e-11	46	223	49	230	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=tarA PE=3 SV=1
Q8NXS7	2.17e-11	46	223	49	230	N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=tarA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001279_01355.