CAZyme Information: MGYG000001279_01836

Basic Information

• Species: Pseudomonas_E fulva
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E fulva
• CAZyme ID: MGYG000001279_01836
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236		26642.81	10.9939

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001279	4682858	MAG	Italy	Europe

• Gene Location: Start: 10349; End: 11059 Strand: +

Full Sequence      

MLRNLLRRLLRALLWFAAVSIVLVLVFRWVPPPGTALMLERKVQSWVSGEPIDLQREWVS
WDHISDDLKVAVIAGEDQKFASHWGFDIPAIQAALAFNERGGNVRGASTLTQQVAKNLFL
WPGRSWLRKGLEAWFTGLMELFWTKQRILEVYLNSAEWGQGVFGAQAAARYHFGVEASQL
SRQQAAQLAAVLPSPLKWNAGKPSTYVASRAGWIRRQMSQLGGPSYLMQLDTSRRP

Enzyme Prediction     

No EC number prediction in MGYG000001279_01836.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	55	218	3.6e-52	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.11e-126	15	231	18	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	1.76e-105	15	224	13	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.32e-77	15	225	34	247	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.56e-66	49	218	6	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	4.65e-34	56	222	67	234	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDC06843.1	5.90e-170	1	236	1	236
AVF57353.1	5.90e-170	1	236	1	236
QPH43798.1	4.85e-169	1	236	1	236
QPH48877.1	4.85e-169	1	236	1	236
CRN06383.1	4.85e-169	1	236	1	236

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.60e-25	55	222	19	187	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.25e-25	55	222	19	187	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	2.28e-21	53	222	36	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	3.16e-18	55	199	26	171	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
3UDF_A	3.32e-18	59	231	42	212	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1J2G5	2.71e-151	1	236	1	236	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas putida (strain W619) OX=390235 GN=mtgA PE=3 SV=1
B0KN61	6.37e-150	1	235	1	235	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=mtgA PE=3 SV=1
Q88CS3	1.23e-147	1	235	1	235	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=mtgA PE=3 SV=1
A5WAE0	3.53e-147	1	235	1	235	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=mtgA PE=3 SV=1
Q1IGD6	8.29e-146	1	235	1	235	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas entomophila (strain L48) OX=384676 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	31