CAZyme Information: MGYG000001279_02957

Basic Information

• Species: Pseudomonas_E fulva
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E fulva
• CAZyme ID: MGYG000001279_02957
• CAZy Family: GT2
• CAZyme Description: Acetyl-coenzyme A synthetase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
644		71135.81	6.3615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001279	4682858	MAG	Italy	Europe

• Gene Location: Start: 158; End: 2092 Strand: +

Full Sequence      

MFDLRHYPHALAVSQAAALSQDDYDRLYRQSVEDPDTFWTAQAQRLTWMKPWSQVQRSDL
RTGQARWFDGSQLNVSYNCIDRHLATRAEQTALLWEGDDPSDTKAISYRELHRQVCRLAN
VLKSRGVAKGDRVCIYMPMIPEAAFAMLACARIGAVHSVVFGGFSPDALRDRILDADCRT
VITADEGVRGGKRIALKQNVDKALASCPAVSTVVVVRRTGGDVAWDDGRDLWYHHAIEQV
DETCPPEPMEAEAPLFILYTSGSTGKPKGVLHTTAGYLLQSAMTFDVVFDYRQGEVFWCT
ADVGWVTGHSYIVYGPLANGAISLMFEGVPNYPDSSRFWQVVDKHQVNIFYTAPTALRAL
MREGLAPLQSTSRASLRLLGSVGEPINPEAWHWYFDEVGQRRCPIVDTWWQTETGGIMLT
PLPGTQTLKPGCATQPMFGVQPVLLDDKGQVIEGPGAGLLAIKASWPGQIRSVHGDHQRM
VDTYFKPMPGYYFTGDGARRDADGHYWITGRVDDVINVSGHRIGTAEVESALVLHDSVAE
AAVVGYPHDLKGQGVYAFVTTMNGVSPDEDLKAQLLALVGKEIGSFAKPELLQWAPALPK
TRSGKIMRRILRKIACNELDSLGDTSTLADPSVVQGLIDTRLNR

Enzyme Prediction     

No EC number prediction in MGYG000001279_02957.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02654	PLN02654	0.0	7	638	15	661	acetate-CoA ligase
PRK00174	PRK00174	0.0	7	644	2	636	acetyl-CoA synthetase; Provisional
COG0365	Acs	0.0	66	620	1	525	Acyl-coenzyme A synthetase/AMP-(fatty) acid ligase [Lipid transport and metabolism].
TIGR02188	Ac_CoA_lig_AcsA	0.0	22	640	5	626	acetate--CoA ligase. This model describes acetate-CoA ligase (EC 6.2.1.1), also called acetyl-CoA synthetase and acetyl-activating enzyme. It catalyzes the reaction ATP + acetate + CoA = AMP + diphosphate + acetyl-CoA and belongs to the family of AMP-binding enzymes described by pfam00501.
cd17634	ACS-like	0.0	24	607	1	587	acetate-CoA ligase. This family includes acyl- and aryl-CoA ligases, as well as the adenylation domain of nonribosomal peptide synthetases and firefly luciferases. The adenylate-forming enzymes catalyze an ATP-dependent two-step reaction to first activate a carboxylate substrate as an adenylate and then transfer the carboxylate to the pantetheine group of either coenzyme A or an acyl-carrier protein. The active site of the domain is located at the interface of a large N-terminal subdomain and a smaller C-terminal subdomain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE6201330.1	3.92e-247	7	638	565	1210
CAE6201338.1	5.38e-247	7	638	576	1221
AFZ04852.1	5.41e-22	69	611	579	1074
AFY93865.1	2.17e-19	106	611	365	842
CAE6256584.1	6.49e-16	254	614	1711	2058

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P20_A	2.00e-290	7	641	5	645	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P20_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P2F_A	4.02e-290	7	641	5	645	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2F_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P2Q_A	4.02e-290	7	641	5	645	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2Q_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
5JRH_A	5.37e-290	7	641	5	645	Crystalstructure of Salmonella enterica acetyl-CoA synthetase (Acs) in complex with cAMP and Coenzyme A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5JRH_B Crystal structure of Salmonella enterica acetyl-CoA synthetase (Acs) in complex with cAMP and Coenzyme A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
2P2M_A	1.15e-289	7	641	5	645	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2M_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q88DW6	0.0	1	644	1	644	Acetyl-coenzyme A synthetase 2 OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=acsA2 PE=3 SV=1
Q21LV0	0.0	7	644	7	645	Acetyl-coenzyme A synthetase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) OX=203122 GN=acsA PE=3 SV=1
Q0VSR6	0.0	1	644	1	645	Acetyl-coenzyme A synthetase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) OX=393595 GN=acsA PE=3 SV=1
Q0AAW0	0.0	1	644	1	645	Acetyl-coenzyme A synthetase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=acsA PE=3 SV=1
Q9HV66	0.0	1	644	1	645	Acetyl-coenzyme A synthetase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=acsA2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001279_02957.