CAZyme Information: MGYG000001279_03014

Basic Information

• Species: Pseudomonas_E fulva
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E fulva
• CAZyme ID: MGYG000001279_03014
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
865		97445.85	7.8254

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001279	4682858	MAG	Italy	Europe

• Gene Location: Start: 241; End: 2838 Strand: +

Full Sequence      

MSSRKFGLNLVVVLAIAALFTGFWALINRPVSAPAWPEQISGFSYSPFRLGESPQKGQYP
DDNEMRQDLEQMSKLTDSIRIYTVEGTQAHIPKLAEEFGLRVTVGIWISPDLERNEREIA
TAIELANTSRSVVRVVVGNEALFREEVTPENLIQYLDRVRAAVKVPVTTSEQWHIWKQNP
QLAKHVDLIAAHILPYWEFVPMKDSVEFVLDRARELKHQFPRKPLLLSEVGWPSNGRMRG
GADATQADQAIYLRTLVNTLNRRGFNYFVIEAYDQPWKASDEGSVGAYWGVFNAERQQKF
NFEGPVVAIPQWRALAVASVVLAMIALMVLFIDGSALRQRGRTFLTFITFLCGSVLVWIA
YDYSQQYSTWFSLTVGVLLALGALGVFIVLLTEAHELAEAVWTHKRRREFLPVHGDSAYR
PKVSVHVPCYNEPPEMVKQTLDALAALDYPDYEVLVIDNNTKDPAVWEPLKAHCEKLGER
FRFFHVAPLAGFKGGALNYLLPHTAKDAEVIAVIDSDYCVDRNWLKHMVPHFADPKIAVV
QSPQDYRDQHESAFKKLCYSEYKGFFHIGMVTRNDRDAIIQHGTMTMTRRSVLDELGWAE
WCICEDAELGLRVFEKGLSAAYAHNSYGKGLMPDTFIDFKKQRFRWAYGAIQIIKHHAAA
LLRGKGSELTRGQRYHFLAGWLPWIADGMNIFFTVGALLWSAAMIIVPHRVDPPLMIFAI
PPLALFFFKVGKIVFLYRRAVGVNLKDALAAALAGLALSHTIAKAVLYGFFTSSMPFFRT
PKNADSHGLLVAISEAREELFIMLLLWGAAAGIYLVQGLPSSDMRFWVAMLLVQSLPYLA
ALVMAFLSSLPKPEAKATEKAVETP

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	421	649	1.6e-29	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06435	CESA_NdvC_like	3.55e-149	424	658	1	236	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
COG5309	Scw11	1.70e-98	1	296	1	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
COG1215	BcsA	4.76e-56	373	745	10	362	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06421	CESA_CelA_like	5.35e-51	421	654	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
cd06423	CESA_like	1.52e-38	425	606	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVF56616.1	0.0	1	865	1	865
QPH43039.1	0.0	1	865	1	865
CRN07165.1	0.0	1	865	1	865
QPH48102.1	0.0	1	865	1	865
QDC03461.1	0.0	1	865	1	865

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.91e-21	60	299	50	289	Crystalstructure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.16e-20	60	299	50	289	Active-sitemutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]
7LBY_A	2.50e-18	357	680	214	534	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	4.78e-18	421	700	128	421	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	5.26e-18	421	700	140	433	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L7	5.94e-18	357	680	214	534	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P37653	1.35e-17	357	680	214	534	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q9WX61	1.54e-17	321	679	54	402	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
Q8Z291	5.35e-17	357	680	214	534	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
D4B2W4	5.41e-17	48	301	26	298	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000005	0.000002	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
7	26
309	331
343	360
370	392
678	700
715	737
749	771
800	819
826	848