CAZyme Information: MGYG000001279_03079

Basic Information

• Species: Pseudomonas_E fulva
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas_E; Pseudomonas_E fulva
• CAZyme ID: MGYG000001279_03079
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		40974.07	9.3953

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001279	4682858	MAG	Italy	Europe

• Gene Location: Start: 1901; End: 3028 Strand: -

Full Sequence      

MAQLCVALVAGEASGDILGSGLMRALKARHPDVRFIGVGGPLMEAEGLQSYFPMERLAVM
GLVEVLGRLRELLKRRKLLVQTLIEQKPDVFIGIDAPDFTLEIELKLRQAGIKTVHYVSP
SVWAWRQKRVLKIRQGCDLMLTLLPFEARFYEEQGVPVRFVGHPLADTIALQADRPAARA
ALGLGDGPVVALMPGSRGGEVGRLGALFLDAAQRLQQQVPGVRFVLPCANAARRAQLEQM
LEGRNLPLALLDGRSHEALAACDAVLIASGTATLEALLFKRPMVVAYRLAPLTYWILKRL
VKSPYVSLPNLLARRALVPELLQDAATSEALVDALLPLLRDGSGQTDSFDEIHRTLRRDA
SNQAADAVLALLEKR

Enzyme Prediction     

No EC number prediction in MGYG000001279_03079.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	7	356	3.9e-140	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	0.0	3	375	1	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.68e-174	6	374	4	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.09e-141	6	368	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	7.88e-137	6	371	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	2.47e-64	8	322	231	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CRN07188.1	1.30e-261	1	375	1	375
QDC03484.1	1.30e-261	1	375	1	375
AVF56593.1	1.30e-261	1	375	1	375
QPH43017.1	3.71e-261	1	375	1	375
QPH48080.1	3.71e-261	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	6.70e-123	4	373	7	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	6.70e-123	4	373	7	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q88MG7	1.18e-242	1	375	1	375	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=lpxB PE=3 SV=1
A5W837	3.38e-242	1	375	1	375	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=lpxB PE=3 SV=1
B0KSB2	5.34e-239	1	375	1	375	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=lpxB PE=3 SV=1
Q1I639	1.03e-236	1	375	1	375	Lipid-A-disaccharide synthase OS=Pseudomonas entomophila (strain L48) OX=384676 GN=lpxB PE=3 SV=1
B1JBP7	1.15e-233	1	375	1	375	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain W619) OX=390235 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001279_03079.