CAZyme Information: MGYG000001281_00315

Basic Information

• Species: 28L sp000177555
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; 28L; 28L sp000177555
• CAZyme ID: MGYG000001281_00315
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000001281_10|CGC1	42266.26	10.5248

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001281	1450753	MAG	Italy	Europe

• Gene Location: Start: 8783; End: 9925 Strand: -

Full Sequence      

MKIMFSVGEASGDLHGAVLAAAIRKIVPEAELFGMGGIKMKQAGVRIVYDIENLGVIGIG
EVIRKIPFFLHLRQYLLTVMKKERPDVLVCVDYPGFNMRLAKKAKGLGIPVIYYILPTIW
AWNKKRGKTIADYTDLAISLFPFETELYQQIGAKAVYAGHPLLDTVRATMPKEEVYKQMG
IVPETKTVLLMPGSRQQEVRRLFPVMLQAARMLQSYVSQVQFIVPRAPTIPRSELERFIA
ASGVPVRIGEHSAYDMMQISTAAIVASGTATLETALMEVPTLLVYKVNTLTYALAKVLVH
LDSIGLPNIIMGRRIMPELWQGQVTPQRIVTTVLPVLTNAVIREQQRRAMSSVRAALGQS
GAVRRIAAIIVRFVKEKQRV

Enzyme Prediction     

No EC number prediction in MGYG000001281_00315.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	357	2.7e-121	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.56e-130	1	379	2	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.40e-119	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.28e-103	3	360	1	362	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.10e-93	3	373	8	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	8.42e-59	1	327	2	307	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO26605.1	6.05e-166	1	377	1	377
CCC72315.1	2.00e-164	1	377	1	377
AVO73783.1	2.00e-164	1	377	1	377
ALG41186.1	4.03e-164	1	377	1	377
AXB81636.1	8.15e-163	1	376	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.51e-59	1	339	7	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.51e-59	1	339	7	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	3.39e-95	3	376	6	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q74AT9	5.05e-92	2	374	8	380	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	3.22e-90	2	378	8	384	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q1D393	8.82e-90	2	374	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B8JE78	3.18e-84	2	367	10	375	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001281_00315.