CAZyme Information: MGYG000001281_01010

Basic Information

• Species: 28L sp000177555
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; 28L; 28L sp000177555
• CAZyme ID: MGYG000001281_01010
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
534	MGYG000001281_59|CGC1	61014.76	9.4826

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001281	1450753	MAG	Italy	Europe

• Gene Location: Start: 5234; End: 6838 Strand: +

Full Sequence      

MHTRIKLLLLGLVCVLFFIIGNASLPVTDPVEANYALTAKEMLRHGDWLSPQIYGLYWYD
KPIFIYWLLYLSYSLFGITDFAARLPGAFFGAATVVLGAWYLHRQSGRWRPALLLAALLS
TSLECWFISHSIITDQPLFFFMCGTLLCAYIALTEGRKGYMTGAYVLAAGAVLTKGPVGL
VLPGIFLLVFCLCQRNRVYLRRLFTWQGILLFLLLGGAWYVPMYLVHGQDFINGFLLFNN
VTRATVSEHPEYNVWYYYFLLVPLSLLPWSGPCFYGWWRERGRRDDWIYATVWIVGTVLF
YTAMATKYPTYSYLADMPLLLFGARALDRLMDRGREKAWFCLTVPTAVFWLALAIAAQTY
HPRTFSLPSLHTFTVFLVIMTVLLGIGQAKKAFPALPYLVTAGTVVMYILLIRQVCVPFY
TYRSAVTLTPCVSRIQGDLYFFHTYPTSFVYYTGHPATCLIPQDTPSSPGRRAVWNKKYV
YPKETESSLLARLRRKHSVSILVPASRDDVFKRSALYPQFSHAETFGNYTLYTT

Enzyme Prediction     

No EC number prediction in MGYG000001281_01010.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	410	2.1e-91	0.7870370370370371

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.69e-36	17	390	20	395	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.34e-18	30	338	31	344	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.18e-11	60	187	1	127	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG4745	COG4745	3.21e-04	44	187	44	188	Predicted membrane-bound mannosyltransferase [General function prediction only].
pfam02366	PMT	0.010	35	190	35	197	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL21032.1	4.28e-197	1	534	1	536
AVO26797.1	1.92e-190	1	517	1	517
ALG41393.1	2.72e-190	1	517	1	517
CCC72525.1	1.10e-189	1	517	1	517
AVO73980.1	1.10e-189	1	517	1	517

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	8.91e-27	30	390	57	428	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	2.66e-27	1	360	1	359	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A0KGY4	6.97e-27	17	339	15	342	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A4SQX1	4.52e-24	10	339	8	342	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A1JPM4	4.68e-24	9	328	11	336	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
Q1CIH9	2.01e-23	9	355	11	362	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.989706	0.009805	0.000374	0.000023	0.000019	0.000100

TMHMM  Annotations     

start	end
7	26
56	78
85	102
112	130
137	154
169	191
204	226
256	278
287	306
338	360
367	389
393	412