CAZyme Information: MGYG000001283_00937

Basic Information

• Species: Scardovia wiggsiae
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Scardovia; Scardovia wiggsiae
• CAZyme ID: MGYG000001283_00937
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588	MGYG000001283_7|CGC1	65204.23	10.0164

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001283	1508369	MAG	Italy	Europe

• Gene Location: Start: 4665; End: 6431 Strand: -

Full Sequence      

MEPDESSSNNIDGDGGAGPEASVLGRQQPGIRTKSRMRVLHGSSTGGSRITLVPSNHRKL
LPGWSQLQAYTHTGGGRRAMGWIVTLAVTIFGGLLRFIRLGSPKGLVFDETYYVKDAWTM
LMTGEARDWPKTIHGTAVNALFAAGQTDNWLPRAENVVHPPLGKWFIALGLKLFGGAGNI
AAWRVATAAAGTIGILLICRIALKLFRSLPLAALAGILMSIDGLGIVMSRTGILDIFIMA
LVLGAFLCLLNHREWALAKLTAYADAHHVSPQTPQNSRNLAGPSVFFSWWRLAAAVLLGL
SCGIKWSGIYFFAVFALISVLWDAYNRHTLGYRFWFASAVVHDGLPAALYMVPTATLSYC
ATWAGWFIHPDSYMHNWAAAHPGEGITWLPETLRSFVEYHRQMWQFHVNLSEPHPYMANA
WMWPLQIRPTNFWLSESAKGTGLCAISPGSPCYSNVTALGNPLLWWIGTLCALLVIIIAV
VDFASRRGNWRVWAVFAGWLGGWLPWLQYLNRTTFNFYAIVLLPWVILSVIYMASWLKAQ
LKKRAYHVIVGIGVAAIVLTSVFFFPLWTGIPLPRGLWAAHMWLYSWI

Enzyme Prediction     

No EC number prediction in MGYG000001283_00937.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	88	367	1.2e-64	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	4.33e-21	394	584	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	3.63e-18	393	588	498	694	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	4.94e-06	87	350	2	233	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	1.74e-04	156	524	133	399	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
COG1807	ArnT	7.78e-04	159	341	64	214	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAR07484.1	6.46e-288	22	588	23	586
BAR06042.1	1.33e-254	65	588	91	608
ATO42176.1	4.41e-221	78	588	51	578
AFU70789.1	4.41e-221	78	588	51	578
ATO40593.1	1.91e-219	80	588	1	497

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	3.94e-64	78	587	34	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	1.76e-61	78	587	40	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.76e-61	78	587	40	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	2.01e-49	64	587	30	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
79	98
180	198
205	227
231	250
285	304
308	325
346	368
463	485
492	510
515	537
549	571