CAZyme Information: MGYG000001283_00943

Basic Information

• Species: Scardovia wiggsiae
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Scardovia; Scardovia wiggsiae
• CAZyme ID: MGYG000001283_00943
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
267		30299.02	7.4289

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001283	1508369	MAG	Italy	Europe

• Gene Location: Start: 13996; End: 14799 Strand: -

Full Sequence      

MRDGLLISVLSLLDHSSGPVNVYVLTASLTTPGHVWKPIDSRDISYIDSLIKDSACGGSA
KLIDISVQFNTQLPYANMDTRFSPYCMLRLYADLIELPDRILYLDTDVVCRKDPGELYAA
DISNIQIAGVPDHYGRLMPTAGFTIPGDYLNSGVLLLNMPEIRSTGLFAGCRELCAEKRM
FLCDQTAINRLARSRAVLPRRYNEQLKTRPDTVLRHFTTTLHLLPKPHTLTVKPWDVDRL
HSVLSEHEFDPLIRKYQYHIKRMNPEL

Enzyme Prediction     

No EC number prediction in MGYG000001283_00943.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	4	235	9.2e-27	0.8171206225680934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	1.02e-36	3	235	13	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	1.63e-20	3	258	15	281	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	3.59e-15	4	235	13	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd00505	Glyco_transf_8	9.77e-10	4	236	15	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
cd06429	GT8_like_1	5.04e-04	4	132	12	148	GT8_like_1 represents a subfamily of GT8 with unknown function. A subfamily of glycosyltransferase family 8 with unknown function: Glycosyltransferase family 8 comprises enzymes with a number of known activities; lipopolysaccharide galactosyltransferase lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase and inositol 1-alpha-galactosyltransferase. It is classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAR07476.1	8.77e-137	1	264	11	274
BAR06036.1	7.12e-131	1	267	11	277
QOV18898.1	3.40e-86	1	256	11	277
ANZ62930.1	9.54e-86	1	257	11	267
ANZ65909.1	9.54e-86	1	257	11	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	3.17e-06	44	203	342	526	ChainA, WbbM protein [Klebsiella pneumoniae]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996964	0.003048	0.000009	0.000005	0.000003	0.000006

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001283_00943.