CAZyme Information: MGYG000001283_01188

Basic Information

• Species: Scardovia wiggsiae
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Scardovia; Scardovia wiggsiae
• CAZyme ID: MGYG000001283_01188
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		37084.32	9.7178

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001283	1508369	MAG	Italy	Europe

• Gene Location: Start: 26910; End: 27950 Strand: +

Full Sequence      

MAGRHIERKGSIFSRFTRKQWIGAAAAAIAVVLIATGGAIAAWRNSGSRASRITEYSVSD
LKDGSQDVSRSTIREALEEHRGGADRNTTYVRVEINGKLRMVAGSGFTTVKSVLQAGNIT
LTNDDTVSPSLDDQVNESTVIKITSTNSEIQTLEQSIPFNVIRKNDDSLPSGSTKVETEG
KEGTMEITNLVTKNGTETLATNTITEYVKNAPINKVILVGTKKAASTSTSERKSASPSSS
SSASYGTTMPVGDAQSYAHSKVLARGWSESEFTCLVQLWQKESGWRSNAANPSGAYGIPQ
ALPGSKMGAGWQTDATVQINWGLNYIAGRYSTPCGAWAHSRKTGWY

Enzyme Prediction     

No EC number prediction in MGYG000001283_01188.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3583	YabE	7.24e-24	93	228	154	290	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
pfam07501	G5	1.19e-16	149	222	2	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
pfam03990	DUF348	8.13e-06	91	132	1	41	Domain of unknown function (DUF348). This domain normally occurs as tandem repeats; however it is found as a single copy in the S. cerevisiae DNA-binding nuclear protein YCR593. This protein is involved in sporulation part of the SET3C complex, which is required to repress early/middle sporulation genes during meiosis. The bacterial proteins are likely to be involved in a cell wall function as they are found in conjunction with the pfam07501 domain, which is involved in various cell surface processes.
cd13399	Slt35-like	0.007	275	305	8	39	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAR04864.1	2.44e-149	1	346	1	354
BAR07171.1	4.13e-127	30	346	9	338
AKV54972.1	6.37e-111	5	346	4	336
AII74342.1	5.09e-109	17	346	16	342
AIC91546.1	2.05e-108	17	346	16	342

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.935638	0.055389	0.001174	0.000862	0.000368	0.006581

TMHMM  Annotations     

start	end
21	43