CAZyme Information: MGYG000001285_01718

Basic Information

• Species: Pauljensenia sp902373545
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp902373545
• CAZyme ID: MGYG000001285_01718
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607	MGYG000001285_101|CGC1	65896.89	7.1041

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001285	2350339	MAG	Italy	Europe

• Gene Location: Start: 1553; End: 3376 Strand: -

Full Sequence      

MDTTNTTHDNPQDVEAPDPHGKVLPAAASENAPAPASSPADTTPEDGAPEDPRPEEPNRE
NETSEASVPHDPAPASSTTGGDIWAARLHTPTAGWVATAVATIIAAIIRMTGLDNVRTLV
FDETYYVKDAWSLITLGYEGTWPNNYDASFVAGNVSGLAVKGGYPVHPPTGKWLIGLGME
ALGQTDPVGWRIVTAICGVITVFLLCRLAQNLFHSPLLTLLAGLFLATDGIAIVMSRTSI
LDGYLAMFALAAFLCVVKDQQMSRPTLTSKLTAWDGIGAPRHGWASLRAFVTLRDQHGFA
IGPNAGRRPWLLAAGILCGLASSVKWSGVYVLACLGLFVAIREVTYRWRLGHPSPVRGAL
IADVWWAFILMVPSAILTYIASWFGWFTHPQAHGHGRSGISGFTGALADLWIYHKEMWTF
HTGLTTPHTYQSNPYTWLAQVRPTSFHWSNDASITGCASGKCATNVVALGNPVLWWIGIG
ALLLVFIVTLRYRNWRSGVILAGYLALYVPWLTYAHRTIFTFYTVAFVPFVALGVAWMVA
LLADAVTISGAAPSSPPPLRSATTGRLLAAALTIAILACAFYFMPLWRGDVVDYEFWRAH
MWLPTWI

Enzyme Prediction     

No EC number prediction in MGYG000001285_01718.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	101	387	4.6e-63	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	2.18e-13	109	342	38	226	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	4.87e-13	413	607	504	694	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	6.36e-13	408	604	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG4346	COG4346	8.76e-10	165	562	134	432	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	1.76e-08	109	370	11	221	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKU65332.1	5.32e-289	73	607	50	584
QQC43974.1	7.55e-289	73	607	50	584
QCT34948.1	1.83e-286	59	607	34	581
QGS11599.1	2.12e-285	64	607	38	581
QGH70911.1	6.92e-120	98	607	3	504

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	2.26e-56	94	606	37	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	1.03e-48	94	606	43	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.03e-48	94	606	43	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	4.07e-45	99	606	39	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
91	113
187	206
213	235
240	257
326	345
365	387
466	488
498	515
520	542
562	584