CAZyme Information: MGYG000001286_01606

Basic Information

• Species: UMGS1872 sp902373635
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UMGS1872; UMGS1872 sp902373635
• CAZyme ID: MGYG000001286_01606
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
688	MGYG000001286_32|CGC2	76377.56	4.1294

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001286	2794921	MAG	Italy	Europe

• Gene Location: Start: 21046; End: 23112 Strand: +

Full Sequence      

MKKILSLLLSMTLVLTLLPSAAFAVMTYTTSEEGVALIAEFEGFRAMPYADDLGNWYIGY
GTSCEPADYPYGITEEEALQLLRQSLISAEDSVNRLLMDYGISVTQYQFDAMASMTYTLG
TQWMNPTYRFCSYLINGIQNYSEAEVVNAIATWCHQGTAVLDNLVSRRLREAYLFLYGLY
DNSGADDYCYIHFDPNGGTIENQTVFYPVGYTYGELPTPAWSGRNFLGWYTADGTQITGQ
ELADGALSVTAKWDGEGSGSSGKTDIDLSAWVNPYSDVKDTDWYYTYVRELSAKGVVGGY
PDGTFQGTKTLTAGEALKLILLAAGCPEQEPVNSHWASGYLALAERMGCLAAGEIQNLDS
PISRLTIARIATIAMGLTPRTGVSPFADADDGYLLTMYEEKILNGTVIGRNRYFYPDDSI
NRAEVCAIVSRISNWEYTEKNDPAQSGYVTYRDKYYPVQRGVAVCPYNPNLFVLDGSTMY
YNDPAYTTALGIDVSSHQGEVDWQKVASSGVEFVMIRLGYRGYGSEGTVNIDPYFQQNLE
GAKAVGLKVGVYFFSQAISTQEAEEEALFVLENLRGWNLEYPVVYDWETVSSSSARTNGL
SGTVLTDCAITFCETVAAAGYTPMIYYNSPVGYTKYELSRMTAYDVWYAQYASMPTMYYD
YRIWQYSDSGTIPGISTKVDMNIAFIPY

Enzyme Prediction     

No EC number prediction in MGYG000001286_01606.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	492	675	8.2e-47	0.9943502824858758
GH24	31	171	5.1e-28	0.9854014598540146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.06e-81	491	685	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	4.40e-39	491	684	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	2.25e-36	492	675	1	180	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	2.21e-32	491	682	2	182	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00737	lyz_endolysin_autolysin	6.14e-30	34	176	1	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL16942.1	1.39e-66	434	685	65	316
QRT51228.1	5.79e-66	458	686	57	285
QCT06482.1	3.15e-63	461	688	90	319
ABX43465.1	1.01e-60	457	688	390	621
BBF45127.1	2.14e-58	480	688	70	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	3.97e-14	29	176	51	194	ChainA, Lysozyme [Acinetobacter baumannii]
4KRU_A	4.06e-14	491	682	22	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	1.96e-13	491	682	22	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
5A6S_A	2.06e-12	493	682	26	199	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]
2WAG_A	3.62e-11	491	685	18	207	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	2.28e-13	491	682	11	194	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P34020	1.17e-10	491	682	3	178	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P76421	2.25e-10	484	683	62	253	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8FFY2	4.05e-10	484	683	62	253	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
Q8X7H0	7.32e-10	484	683	62	253	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000288	0.999061	0.000176	0.000166	0.000151	0.000150

TMHMM  Annotations     

start	end
7	29