CAZyme Information: MGYG000001289_01177

Basic Information

• Species: Streptococcus sp900543065
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900543065
• CAZyme ID: MGYG000001289_01177
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233		25430.09	4.779

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001289	1985520	MAG	Italy	Europe

• Gene Location: Start: 18863; End: 19564 Strand: +

Full Sequence      

MKIKIRNKTKLLGFIVSVVAVGTFVAAMSEHVPSVGANDGTYQGYQDPTEAFISQIGESA
RQLGQENDLYASVMIAQAILESGSGQSGLASYPHYNLFGIKGSYAGQSAVLQTSEDDGSG
NMYSINDEFRSYPSYYESLQDYVAVLKQGHFAGAWKSNTSSYQDATAALTGVYATDTSYN
VKLNHIIEAYNLTQYDSPNVQGGVTGSVYNPYRQQFTSQEILNLDIAWANRLR

Enzyme Prediction     

No EC number prediction in MGYG000001289_01177.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	57	192	1.2e-28	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK08581	PRK08581	1.03e-69	49	213	320	500	amidase domain-containing protein.
PRK06347	PRK06347	9.11e-67	50	210	151	317	1,4-beta-N-acetylmuramoylhydrolase.
COG1705	FlgJ	6.72e-61	3	196	1	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	3.30e-28	49	196	8	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	1.56e-24	49	196	160	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB38120.1	6.06e-157	1	233	1	233
AEH55608.1	3.08e-150	1	232	1	232
AFJ26130.1	3.83e-150	1	232	7	238
QEW09809.1	7.52e-149	1	232	1	232
QWL83048.1	3.17e-148	4	232	6	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T1Q_A	3.66e-43	23	196	31	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3FI7_A	1.08e-41	50	196	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	9.82e-15	52	188	6	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.34e-14	52	188	6	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	1.36e-11	50	194	2	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	2.76e-49	46	211	178	348	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	6.30e-44	7	205	19	226	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q2G222	1.42e-41	23	196	291	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P0C2T5	1.01e-39	43	202	56	220	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	5.37e-39	43	202	56	220	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.021560	0.927922	0.049533	0.000368	0.000294	0.000296

TMHMM  Annotations     

start	end
12	29