CAZyme Information: MGYG000001289_01253

Basic Information

• Species: Streptococcus sp900543065
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900543065
• CAZyme ID: MGYG000001289_01253
• CAZy Family: GT113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334	MGYG000001289_19|CGC1	38510.88	4.7055

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001289	1985520	MAG	Italy	Europe

• Gene Location: Start: 9461; End: 10465 Strand: +

Full Sequence      

MKIHFTNLFGQSPQSVALMAQNDIMNVVRELGVNELGIYFYDHSNEPEGELNSRMDGILA
SVAFGDIVFVQSPSWNGIEWDRRLVDKLKLLQTKLILFIHDVPPLMFESNYDLLPAYIDM
YNQSDLVIVPSEQMYRHLVSEGLTVKKFVVQKLWDLTHSLDLYTPQFEKKLIFSGNPSRF
PHIIDWKYDTPLHVYAEPVEGVDYSKVHMEGWRTKQELLLELSKGGFGLVWGNSEHPEDE
RDYYKENISYKLSTYLSAGLPVVVPDYLSNADYIREKGLGFVASSLEEANRLVQECTEEE
YAQMVQKAQYTSYLIRNGYFTKKLFVDALMALGE

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	17	328	1.5e-79	0.9596273291925466

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	6.58e-127	1	332	1	333	sugar transferase.
cd03794	GT4_WbuB-like	6.72e-05	66	283	100	344	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG0438	RfaB	1.23e-04	33	308	52	353	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03817	GT4_UGDG-like	7.29e-04	66	184	86	205	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
pfam13439	Glyco_transf_4	0.010	66	150	74	161	Glycosyltransferase Family 4.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEW10473.1	1.25e-236	1	334	1	334
QUB38758.1	2.81e-233	1	334	1	334
VTS73155.1	3.11e-198	1	332	1	333
ARI56928.1	2.38e-188	1	333	1	333
QMI51340.1	2.76e-187	1	333	1	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QKW_A	2.90e-88	1	329	3	326	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	3.60e-88	1	329	11	334	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]
4W6Q_A	3.60e-81	1	331	3	328	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AEU1	1.89e-139	1	330	1	330	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
A0A0H2UR93	9.33e-126	1	333	1	334	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
B3XPQ7	3.11e-93	1	332	1	332	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	3.76e-93	1	332	6	337	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1
B5A7L9	1.49e-87	1	329	1	324	Glucosyltransferase 3 OS=Streptococcus parasanguinis OX=1318 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001289_01253.