CAZyme Information: MGYG000001289_01546

Basic Information

• Species: Streptococcus sp900543065
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900543065
• CAZyme ID: MGYG000001289_01546
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200		22578.8	6.8823

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001289	1985520	MAG	Italy	Europe

• Gene Location: Start: 19418; End: 20020 Strand: +

Full Sequence      

MIKRILKVIFFIFIIFGIFKGIQIHHDVKQVLQYRSLVREALANEDTTANENLILAMIYT
ETKGREDDLMQASESASGETNTISDNKASIRQGIQTLSDDLKEAKKKGVDSWTAVQAYNF
GKDYIDYVAKHGGTNSLELARAYSRDVVAPSLGNVTGKTYLYLHPISLLNGMELYVNGGN
IYYSRLVETNMTIMNLFSWF

Enzyme Prediction     

No EC number prediction in MGYG000001289_01546.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	3.47e-81	28	190	1	164	Lysozyme-like.
cd16891	CwlT-like	1.01e-65	34	187	1	146	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG0741	MltE	0.003	25	191	117	280	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB38067.1	4.54e-138	1	200	1	200
QWL82947.1	2.71e-130	1	200	1	200
AEH55525.1	2.71e-130	1	200	1	200
AFJ26027.1	2.71e-130	1	200	1	200
QEW09758.1	3.85e-130	1	200	1	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	1.87e-17	30	193	23	179	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	9.26e-16	30	192	25	179	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AHT6	1.35e-81	1	200	1	200	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pvaA PE=4 SV=1
Q8DPY9	1.92e-81	1	200	1	200	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pvaA PE=4 SV=1
Q8P120	1.84e-73	4	200	3	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=pvaA PE=3 SV=1
Q5XC63	3.70e-73	4	200	3	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=pvaA PE=3 SV=1
Q99ZN9	7.45e-73	4	200	3	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.684580	0.248680	0.061651	0.000936	0.000623	0.003530

TMHMM  Annotations     

start	end
5	24