CAZyme Information: MGYG000001289_01811

Basic Information

• Species: Streptococcus sp900543065
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp900543065
• CAZyme ID: MGYG000001289_01811
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		48714.31	6.8749

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001289	1985520	MAG	Italy	Europe

• Gene Location: Start: 59; End: 1336 Strand: +

Full Sequence      

MKKIKIDVVAVPLSGHLYPTLNLVKPLLDDPTMEIRVFTGPQKKAVAESLGFTVVPILED
KIEEFERAANNEKKLNLFSAYRQLSKSLDLINHVSDQLLEEWRVNRPDIVIADFITLSAG
FVAEQLEIPWITTMATQFAIETPYGPPCFFGGMGVARTKKEEKIQALCRKLTRIGKYCVA
FLLRKRLKRYNYKLYNQNGVETIYSPYAIFGIGMMELELKTHFPHQYAWLGPLGTSLEKA
EDYPLDLSPYEDKKKILVTCGTQLPWAKENLLHQTKQLAKEHPECHFFVTLGDGAKEFSE
EEVAPNVTVVSYLPYKEYIPQMDYVIHHGGAGIFYQCIEFKKPALILPHDYDQFDYAIRG
VEAGIAFQAHRNRTEEIQAGFNALLEKESWEELARLNKLSKTYKPLDTLEFEIQRLLRRG
TDGKL

Enzyme Prediction     

No EC number prediction in MGYG000001289_01811.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	94	416	3.6e-16	0.774869109947644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	3.26e-30	5	403	3	385	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	6.90e-30	5	396	2	384	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
TIGR01426	MGT	1.04e-11	11	366	3	336	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam04101	Glyco_tran_28_C	0.003	256	351	2	101	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB38075.1	2.38e-312	1	425	1	425
AFJ26032.1	1.38e-311	1	425	1	425
AEH55529.1	3.95e-311	1	425	1	425
QWL82965.1	6.55e-310	1	425	1	425
QEW09764.1	1.09e-308	1	425	1	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	1.03e-11	1	365	1	330	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	1.06e-11	1	365	1	330	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
7LVY_A	2.66e-07	302	418	339	458	ChainA, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_A Chain A, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_B Chain B, UDP-glycosyltransferase 203A2 [Tetranychus urticae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34539	5.78e-11	1	365	1	330	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001289_01811.