CAZyme Information: MGYG000001292_02371

Basic Information

• Species: Bifidobacterium infantis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium infantis
• CAZyme ID: MGYG000001292_02371
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721		79607.43	4.5103

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001292	2832748	Isolate	not provided	not provided

• Gene Location: Start: 2478489; End: 2480654 Strand: -

Full Sequence      

MSEITESEERLARPLIRLAKLVGVGTSYVGMSHDYHEIDDDVLIEVLAALGIDASSENAQ
LIAIRRILNERYSRLVAPTVLHIAGSEDRVLVNTGILDVPSASITLENGEPYQGTVEVGP
GDGSQAYDLDGTFISNAAVVIPADLPIGYHTLHVKVADRVQDATLISAPDRVDLLDPMKG
GSLWGWMAQLYSIRSSNSWGVGDYEDLKTMLVDAKQKTGADFVLINPVHAAEPVSPLTPS
PYLPVSRRLINFTYIRPEAIVEYATLSEGDKNAVDGLHADTEPLNGDSQLIDRDAMWRSK
MHALWIIFKAGRTAERQSAFDQFKADYGSDLEAYATWCLCYDKWGAPNGEESNWERKFNR
NSPEIANLRKQYPDTLDFYRWLEWIAAEQLSSAQQTAKDAGMHIGIMSDMAVGVHPSGAD
VWWNPERFAKGATVGAPPDMFNQQGQNWSQPPLSPINLEATGYETYRNMVHGMFARAGAV
RIDHILGLFRLWWIPENRSAMDGAYVYYDSDIMLGVLAIEASRAGGVVVGEDLGVVPDHV
ADSLSSHGILGCAVEWFEQRDGVFRAPSQWRPYALASVNTHDLPPTAGYLEYEHVKIRER
LGLLTGPVEEFEASAKTEQDAMLAMLVEQGYLDADFAEHREDHEADIVDALYRALKGSPC
KLLAASITDAVGEKRAQNQPGTNNEYPNWRIPLADAKGNVVPLETLFDTPGAQRFAQIFN
S

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	189	697	4.1e-137	0.951417004048583

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14507	PRK14507	2.91e-137	14	694	7	698	malto-oligosyltrehalose synthase.
PRK11052	malQ	4.47e-134	18	717	9	683	4-alpha-glucanotransferase; Provisional
COG1640	MalQ	1.19e-131	183	719	13	512	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
pfam02446	Glyco_hydro_77	6.96e-130	189	693	2	459	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PRK14510	PRK14510	4.03e-93	151	713	692	1208	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG44204.1	0.0	1	721	1	721
ACJ53305.1	0.0	1	721	1	721
BAJ69895.1	0.0	1	721	1	721
ALE08416.1	0.0	1	721	1	721
QOL44442.1	0.0	1	721	1	721

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B68_A	1.63e-153	13	717	5	701	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]
4S3P_A	5.59e-99	104	714	80	678	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	3.72e-93	104	714	80	678	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]
1TZ7_A	7.10e-16	240	601	76	424	Aquifexaeolicus amylomaltase [Aquifex aeolicus],1TZ7_B Aquifex aeolicus amylomaltase [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WK22	1.30e-179	11	717	4	711	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P9WK23	1.30e-179	11	717	4	711	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1
P65337	1.30e-179	11	717	4	711	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P15977	2.91e-98	104	714	80	678	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2
P45176	1.84e-87	134	715	99	689	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001292_02371.