CAZyme Information: MGYG000001293_00669

Basic Information

• Species: Lacticaseibacillus rhamnosus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus rhamnosus
• CAZyme ID: MGYG000001293_00669
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
795		87091.91	6.1113

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001293	3010111	Isolate	not provided	not provided

• Gene Location: Start: 696809; End: 699196 Strand: +

Full Sequence      

MDNSASNINVDQLTTEEKMKLTSGKDFWASEALPDHKIPSIRMSDGPHGLRYQAAAADHL
GINDSVPSTSFPTASASAATWDPELIAAMGAAIGLEAQSLGVDVVLGPGVNMKRNPLCGR
NFEYFSEDPYLAGKLGAAWIQGMQKQGIAACLKHFAANNQENGRLSSDSMIDPVALHEVY
LEAFRIAVTEGHPESVMCSYNKVNGTYTSDNRYLMTNVLRDQFGFDGAVITDWGALNDKV
AALNAGTDLEMPGDDHLFDDEALKALQSGELQPASLDRAAANIIKMARKHRPSFHGTREA
LLHQNAQLAQKIAENAIVLLKNDDHILPLQTSESLAVVGEMAKGTRFQGAGSSHIQAAEQ
VSILSGIKQAGLTYDFAAGYRLDDEVDQEKTAQALELARTHDKVIFVAGLPDNYESEGFD
RKNMALPKVQNDLLQAIAAINPHVIVLLVAGAPVEMPWLDQVQAILNLYLGGEHIGTATA
RVLTGQVNPSGKLAETYPKRYQDVVSAEIYDKHTRAVPYVESSYIGYRYFDKAKVPVAFP
FGFGLSYTTFAIKHVRLVNDEVTDAQPVTVQLDVTNTGDMDGAEVIQAYVKEQQPRPLRP
EKALKAFKKVFIKAGETVAVQLELPAQAFKEWQEKTQTWVLPAAAKSVAIGTSAADIVAT
LPVHLNGTNVTNFKNVPDWYTTLSGKPTVHDFEQLTGQKVPPHHEFVPGEFTRLNTPREM
QKHSWIVRTVTRITVRMRTKDYLDKEGPEAKFQQAIVLDTPLIRLAQQASGILKLSMVDR
LVAAANHQYLKMIFG

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	252	5.3e-72	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.32e-92	69	657	118	757	beta-glucosidase BglX.
COG1472	BglX	5.46e-71	25	373	47	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	4.62e-62	10	622	57	740	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	7.88e-59	317	547	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.20e-40	69	284	86	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ART95144.1	0.0	1	795	1	795
QTN17870.1	0.0	1	795	1	795
AQY33930.1	0.0	1	795	1	795
QUH17317.1	0.0	1	795	1	795
QFG48247.1	0.0	1	795	1	795

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.93e-190	10	668	9	671	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.51e-169	10	667	9	665	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.73e-120	12	657	10	705	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	5.61e-119	12	657	10	705	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	5.11e-108	6	659	2	830	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.06e-189	10	668	9	671	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	1.30e-166	10	681	9	686	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	2.59e-166	10	681	9	686	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
A7LXS8	7.48e-120	10	661	50	741	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BB53	6.65e-115	10	639	10	805	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001293_00669.