CAZyme Information: MGYG000001293_02705

Basic Information

• Species: Lacticaseibacillus rhamnosus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lacticaseibacillus; Lacticaseibacillus rhamnosus
• CAZyme ID: MGYG000001293_02705
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1782		193968.59	6.2727

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001293	3010111	Isolate	not provided	not provided

• Gene Location: Start: 2825057; End: 2830405 Strand: -

Full Sequence      

MHNGMKTVKDRPRVPRSLLYSSAVLSLTATVVYVSSTVPVTAAKGSEPAKSSAVKKASTS
MLNIVNVTKQTHYFEVTYSNNLKARVFILANNQFRFYADPSGKFAAPAQSEKGLNAKIFT
KEIDASAAKAFAAATLDHNGDGWTIKTDAIAIGFNQANATLQVSQGSKVVMAESQPLEIT
NDHATQVLKRGTDQFFGGGTQNGNFTLTGKNVKIENTGNWVDGGVASPNPFYWSTAGYGV
VRNTFKLGNYDFGASDDGQVKTTHQENRFDAVYFFDAKPYDLLKDYYDLTGAPAMMPRYG
LYEAHLNAYNRDTWVPVPEGTSGAIKFEDGKYYKEYQPGKIPAGQSGIKESLNGELNNYQ
FSARAVIDRYQKNDMPLGWFLPNDGYGAGYGQTDTLAGNLQNLKSFADYADQHGVATGLW
TQQNLSPVDPANPKPDDRDFAKEVAIGVKALKTDVAWVGSGYSFGLDGLAKADAMMTQVK
GDSLRPFAITLDGWAGTQRYAGVWTGDQTGGQWEYIRFHIPTYIGTGLSGQPYVGSDMDG
IFGGGNPIVNTRDFQWKAFTPIQLNMDGWGANPKTPFSFDQQTTAINRAYNKQKTMLMPY
NYTASAQSVFDGKPMVRGLFLDYPNIPEAYTDLVKYEYLWGDNFLVAPIYQNTAADEKGN
DVRNGIYLPDKQQVWIDYYTGKEYRGGQVLNNFEAPIWKLPVFVKKGAVIPTTPAHNTPK
AFDQTKRQFQIFPASGKNDFTVYEDDGISKKYLKGAHAQTKVTSELQKDQLTVNVDPLTG
DYSGLNPDRATEFAIRTSGKPAKVTASVGGQTVKLTAVDNLKDFTAGENVYFVNKQYHTN
DFLDQLADKSIDQNFLQVKLGKTNVKSNAIKLTVDGINATDDPTTEALPESDEVAVPTEI
KQNDQTTTDTTVGIDWKPVKDATSYDVKADGVVYRNLTKPEFLLTPVKSQTKHTFQVRAA
TAKAVSKWSNEQTFSSKDNPLRLAVKMSNPQVTSPITGVATWQGKDTAAHLFDQDLTTMA
HSNWFTTPPKQSATPMTITTELDGVYDLDHVTYVPREDGGNGTLSALKVETSLDGIHWHQ
AGEGKGWTWDGKDKTITFDKNEKAQYVRFVIPKGTSRGDFVSGRELLLFKRDGSSKAVLG
DITNDGRVNEDDQTSLMNYAGLTANIDSDFNGYVQNGDLNRNGVIDAFDINYVMTKLGKT
PVTKPDEQAPAGTLALEAEKQTYLPGETITLNLLGKDLANVNSLFARVPLTNPNVELVKV
EPTQATAQMVNFSKTRTHGDNSRDLYLIFANEGQQKRLSGDQKLATITLRAKTRMTKAAL
SFALSDPMLTNQWGPENLPQVPAPITILPADTSALDQAKAQLTALIDGINALDPKLFTTV
SWQAVAAQRDKASQVLNVDNVTVDALNQAYADLKHALGKLEADRGVTQDQLKKLIEAAEA
LKADQYTAESFAKLTDAVATAKPVSADANATQAQIQAAIQAISNAWFALEVKQQPQATAL
EQWVKVAANLNAADYTPNSFTQLTTVLDEAKKALTDPTTSAATQQKLADQLQGAIDALVP
RADKQSLAALVKATEKLKASDYTASSYAKLQTALKPARLVLNDPNAAQAEVGKQADALMA
AMLQLEKQPDKTELVSLITKAAEFKAETYTDVSFADLQTALAQARAVNKDSEAAVAKVEA
AVANLKAAIDHLVKAAPTPEPGKDPGNPPVPTPEPGIPPKDKTPQPHAGFNGESADTHKS
TKDRDQMPNAGDRAQPVLAVLGATLIGLLGYVKLRQHHKNND

Enzyme Prediction     

No EC number prediction in MGYG000001293_02705.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	474	710	9.3e-60	0.5245901639344263
CBM32	1001	1125	1.2e-16	0.8790322580645161

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06596	GH31_CPE1046	1.60e-171	289	681	1	334	Clostridium CPE1046-like. CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	3.37e-69	191	781	157	741	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	1.60e-55	273	710	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06589	GH31	4.53e-41	362	590	25	264	glycosyl hydrolase family 31 (GH31). GH31 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite -1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed. Most characterized GH31 enzymes are alpha-glucosidases. In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes. The lysosomal acid alpha-glucosidase (GAA) is essential for glycogen degradation and a deficiency or malfunction of this enzyme causes glycogen storage disease II, also known as Pompe disease. In the endoplasmic reticulum, alpha-glucosidase II catalyzes the second step in the N-linked oligosaccharide processing pathway that constitutes part of the quality control system for glycoprotein folding and maturation. The intestinal enzymes sucrase-isomaltase (SI) and maltase-glucoamylase (MGAM) play key roles in the final stage of carbohydrate digestion, making alpha-glucosidase inhibitors useful in the treatment of type 2 diabetes. GH31 alpha-glycosidases are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06603	GH31_GANC_GANAB_alpha	3.39e-38	485	749	213	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAR88657.1	0.0	1	1782	1	1782
ART95931.1	0.0	1	1782	1	1782
QOX85092.1	0.0	1	1782	1	1782
AQY35822.1	0.0	1	1782	1	1782
AON64210.1	0.0	1	1782	1	1782

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M76_A	0.0	54	982	30	963	GH31alpha-N-acetylgalactosaminidase from Enterococcus faecalis [Enterococcus faecalis ATCC 10100],6M77_A GH31 alpha-N-acetylgalactosaminidase from Enterococcus faecalis in complex with N-acetylgalactosamine [Enterococcus faecalis ATCC 10100]
7F7Q_A	0.0	54	982	30	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
7F7R_A	0.0	54	982	30	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
6JR6_A	6.35e-40	135	830	94	803	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
6JR8_A	8.41e-40	135	830	94	803	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	5.68e-38	193	805	147	765	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
B9F676	7.98e-32	270	756	331	825	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
Q9FN05	1.74e-28	270	757	333	828	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
Q9P999	1.65e-27	485	773	405	684	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
Q9BE70	6.88e-26	469	753	405	679	Neutral alpha-glucosidase C (Fragment) OS=Macaca fascicularis OX=9541 GN=GANC PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.340677	0.654773	0.001573	0.002022	0.000491	0.000449

TMHMM  Annotations     

start	end
21	43