CAZyme Information: MGYG000001294_00431

Basic Information

• Species: Parasutterella excrementihominis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Parasutterella; Parasutterella excrementihominis
• CAZyme ID: MGYG000001294_00431
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
919	MGYG000001294_4|CGC2	105613.79	9.9043

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001294	2614765	Isolate	not provided	not provided

• Gene Location: Start: 167531; End: 170290 Strand: +

Full Sequence      

MLFSQILSQVKVHTGRLSRWLTNNCSGKWSYRINMFCFGLAWLIFPIENRFYQKIVKNRT
YYFPQIDFHNLRPLDPIRGLIQLSFLMFVAGSKEDAAKRLSHSTYASRFFLFRWVNHIFK
RINRGTRMIAERVSKKLASEGKEKTGQHKPQHQKLSLFKKIFVGFLLAIGFVLYVLCITQ
PFSLEEQVIFLLILGVIALTLFQAQTRFTLLMLIVISVIVSSRYVWWRYSETLNPNSYTS
VIFTWLLIIAETYAFIVMLLGYFQVCWVLDRKPASLPKDKERWPSVDIFIPTYNEPLDVV
KPTVYAALTVDWPKEKLNVYILDDGSRKEFKDFACEVGAGYIEREEHKHAKAGNINHAMG
ITKGDFIAIFDCDHVPVKTFLQKTMGWFLKDEKIALVQTPHHFYSQDPFEKNLHLKENVP
NENSLFHDFIQKGNDTWNATMFCGSCAIMRRKALEEVGGIAVETVTEDAHTSLKLNRRGW
SSAFLSTPLSAGLSTETLAAHIGQRIRWARGMVQIFRLDNPLFGKGLTIPQRLCFLNAMI
HFLHGLPRIIFLIAPLPFLFANIYVIYASAIAIFVYLIPHMVHSTMTTYMIHRGYRFPFI
SALYETILSWYIFVPTLVALIAPHKGKFNVTAKGGVIDKEYLDWAVARPYFYLLLLNLAG
FFIGLYRMVGASAYEVLMLLINLGWIIYNLIILFAAMAVTVESVQKRKFPRVSFTAPVHL
QVGETSIPAVMSAFSQKDCVVDLKNASDLSKVSLEEPVKLVFGPKKKPSTTFDCTVTAAF
ENGVVELLVSQPTRTKEMEYVECTFGTPDIWIQRQAKVRDYGMFDGFFALLHMARMGAEA
FAHFSNPQAGWFLKASVWTFKWVISFIPRVPSLRRENKNSPFEETHPLYLPKTICLKQFH
RLIARNNKLKSYAVRNNTD

Enzyme Prediction     

EC	2.4.1.12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	287	458	7.9e-38	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11498	bcsA	0.0	35	881	23	852	cellulose synthase catalytic subunit; Provisional
TIGR03030	CelA	0.0	159	834	6	698	cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.
cd06421	CESA_CelA_like	2.15e-118	284	516	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	2.07e-60	241	696	10	430	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	9.86e-33	288	517	2	233	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ96025.1	0.0	21	882	21	884
ANU67170.1	0.0	21	882	21	884
QQS88758.1	2.65e-290	16	872	16	861
QDA53875.1	4.64e-282	16	844	16	852
QIU90883.1	5.69e-259	39	871	42	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.93e-253	27	871	28	856	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	3.09e-106	223	834	67	708	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.83e-105	223	834	79	720	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.87e-105	223	834	80	721	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8Z291	1.11e-254	40	871	43	856	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
Q93IN2	4.43e-254	40	871	43	856	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
P37653	5.87e-254	27	871	28	856	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q8X5L7	2.66e-252	27	871	28	856	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P58931	5.65e-198	169	811	44	682	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999876	0.000134	0.000001	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
30	52
161	183
188	202
209	226
241	263
533	552
556	578
599	621
644	666
679	701