CAZyme Information: MGYG000001295_01164

Basic Information

• Species: Desulfovibrio fairfieldensis
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio fairfieldensis
• CAZyme ID: MGYG000001295_01164
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000001295_3|CGC2	42147.91	5.3535

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001295	3663932	Isolate	not provided	not provided

• Gene Location: Start: 392304; End: 393443 Strand: -

Full Sequence      

MLRRKTLVILSLSLGSALLLLGLLAGFVPQSEGPEVRRRASAHVVSLRPEDLPEPIVSRG
DGTRLWAVRLPAVSPDAVRRIETDDPDLSGRAGQADTDQIISFEKSGVRLDMGGDDLLFG
EEATPTDLAPLLALDGVSMPLLVTAQPRQYGDALDARGRPLRWQAAETLLSGYTPVNPRP
ADSGRKAAEEMLPEDAYFDGGGLFARARRYQQLVENFARRYNLSAELVYAIIHSESDFSP
TLVSDKSAMGLMQLLPSTASDEVHRFLYGRPGDVSFDELRVPEINIRYGTAYLHILLTRY
FQDVSDPLSREYCAVAAYNMGPNRFLRLYGKTGEEAVARINELSAEQLYEDLTARLPVRE
TRFYVAKVRRMKGQYAELR

Enzyme Prediction     

No EC number prediction in MGYG000001295_01164.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	210	371	2.1e-22	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	3.55e-70	214	372	3	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	2.32e-39	117	375	107	356	membrane-bound lytic murein transglycosylase MltC.
cd16896	LT_Slt70-like	8.40e-37	209	370	3	142	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.53e-30	208	368	4	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15470	emtA	2.51e-27	206	370	35	198	membrane-bound lytic murein transglycosylase EmtA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMD88640.1	6.02e-269	1	379	1	379
VZH33299.1	1.33e-148	5	378	5	356
QCC84560.1	3.64e-147	3	379	3	392
QTO41915.1	2.72e-146	3	379	3	410
ATD80276.1	7.70e-146	3	378	3	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	5.75e-30	117	375	89	338	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	1.52e-29	117	375	89	338	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
2Y8P_A	3.82e-21	206	368	18	179	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	4.69e-21	206	368	35	196	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GI4_B	5.27e-21	206	368	18	179	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6D8K0	1.17e-30	117	375	106	355	Membrane-bound lytic murein transglycosylase C OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=mltC PE=3 SV=1
Q7N7I2	2.25e-30	143	375	126	355	Membrane-bound lytic murein transglycosylase C OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=mltC PE=3 SV=1
Q9CLB8	2.29e-30	117	375	105	354	Membrane-bound lytic murein transglycosylase C OS=Pasteurella multocida (strain Pm70) OX=272843 GN=mltC PE=3 SV=2
Q8Z3T9	4.53e-30	117	375	108	357	Membrane-bound lytic murein transglycosylase C OS=Salmonella typhi OX=90370 GN=mltC PE=3 SV=2
Q57K03	6.27e-30	117	375	108	357	Membrane-bound lytic murein transglycosylase C OS=Salmonella choleraesuis (strain SC-B67) OX=321314 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.989537	0.007855	0.001057	0.000075	0.000041	0.001467

TMHMM  Annotations     

start	end
7	29