CAZyme Information: MGYG000001296_01062

Basic Information

• Species: Pediococcus acidilactici
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Pediococcus; Pediococcus acidilactici
• CAZyme ID: MGYG000001296_01062
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1660	MGYG000001296_1|CGC14	191168.89	8.4528

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001296	1929633	Isolate	not provided	not provided

• Gene Location: Start: 1047314; End: 1052296 Strand: -

Full Sequence      

MKREFVRGKLSIIVPCYKVEDYIKECLDSLANQTYKDIEVIMVDDGSPDNTGAILDEYDS
KYPTFTAVHTPNGGLSAARNAGLDYVTGEFLAFVDSDDVVPKNAYEKLVGSLLQTGSDLA
SGFVNRFNSKKVYPSVLHEKAIPETLLQTNINVNTNLVYDTTAWNKVYKAEIFIGNGLRY
PEGLTYEDIPVSMRYHLLAKSVDVIAEDTYHWRVREGANQSITQQRANFQLFWDRMQTLE
MARKSILELGGSPELKEAFNFKVLDMDIPLYLNGFQNASEETLFKFQRDLVKFLRNYDLS
VIKELSIRKQIQYYALLNGDFPDFKRYGYQYKKIGEIVGDHGRYRYINKALRPELAEKIE
LTKGAVEGKSKVDRVYWENDQAIVEGRCFISQIAKFEKSNFAFDAHIRNTHSHQSTNIEV
IDKKKTKRRRIFWGTTYYAFKLAINVKDVLAQIGAGRWVIDLIATDLDLTITTPVGSPVR
RRNALLTPERIASGTEEYVINNDFNRAWNLFFDVQPKMQNHILAGNLPLVKDFKLTDKNI
LTFDFLTDKNLIDPLFMFSYGKDERYASRVELIQEERDCFKYRISFDCNDLENGITSGRL
YLYNATNMGRYQFRFSLNEQVFTLTNGSCKARVDVSSSLRGVHLIFEKNSAKVENYTLVN
GVLQLTFSVSSKLINDLTSKVQFLMISTDAKESYDAFEVNPLTNDRFEVNIKFSDGKKPL
FKSGYYNFFVDIAGDENNVRIPILMADYQSRNILQISRFKNLKLKLQVNDVGRFQIGLLQ
QWDWIDNSVRKRKVAYYIAYPLMRLLPLSSKTVVLESFWGRSFDDNPRAIYEYWQKAHPE
YKFIWPVTDLSTKVSGQGKVIRRGSFKYWYYLATAKYFIQNTNFPNSYVKRRGQVEVETL
HGTFMKKMGLEEPSMRNSTAKGQRNFMKRNRRWDYLISPSAYMDRVGANAFDFKNEVLSV
GFPRNDELINNNNPEFIKNLKLNIGIPLDKKVVLYAPTYRQAGKLDFEMDLKVMQDKLAD
DYVVLVRLHHLVANAIDIHEFEGFAYDLSAYPNIADLYLIADVLITDYSSVMFDYGYLKR
PMIFFAYDLDWYLDDSNRGVYLDYVKTVPGPIARSTEQIIHYLQKPDKLEAEYGSKLEWF
YNEFCTYGRDGDASKNTVEQVINNNITRDNGEKGFFTSKLARALGVTSLEMGALNLFGQF
LKRSKLIVFENNGGRATDSDPRALYEYLKAHPNGYKLLWLASADQTERFRSAALPYVIKK
SLKGIVARARASFYITNSEVAVNWKKPRGMKVIQTGNGSPLKKVGTDLSSDFIPGQSIYQ
YQKNQVIEGRKWDYLLAGNATAADLQKNAFRLGDNQIVMSGLPRIDQLLDMDSTKREKIR
QELGITATKRVILYEPTWRDDEIVYVDQYGMESKVDFEKLSRSLPKDVVVLVKFHPLITS
GRPKFKKLDNIIDVSDWQSNVELLAVADLLVTDYSSVLFDFAVTNKPMIFMAPDLEEYQD
YVRGLYVEDYEEFVPGPVVRSTAELLEAINSWISADPKWRDYQRKVEKFNQEYNSWNDGR
SAQKAMNYVFNRSCYSVEKISNPVESIKLKDATLLWSGVYGQKDTQFLGNFDIAQADAVT
FTVLETRVLEDPINKTLVGAKFFKIKIADKFVWVSEHSAE

Enzyme Prediction     

No EC number prediction in MGYG000001296_01062.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	11	133	8.7e-37	0.7294117647058823

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	8.35e-107	807	1161	1	358	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
pfam04464	Glyphos_transf	1.64e-88	1202	1571	2	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	1.46e-73	792	1165	8	388	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
COG1887	TagB	2.74e-63	1202	1572	24	387	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
pfam00535	Glycos_transf_2	7.47e-36	11	173	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZP91327.1	0.0	1	1660	6	1665
QQP83128.1	0.0	1	1660	1	1660
QHM52274.1	0.0	1	1660	1	1660
QHM53475.1	0.0	1	1660	1	1660
AVL00631.1	0.0	10	1660	7	1663

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	2.08e-81	692	1155	207	708	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	1.71e-80	692	1155	207	708	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	4.22e-80	692	1155	207	708	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
5HEA_A	2.35e-35	10	221	7	225	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	6.19e-25	9	105	6	102	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RKI5	7.46e-81	796	1162	17	393	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q5HLM5	9.58e-81	692	1155	207	708	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
P13485	2.00e-78	796	1162	367	743	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q2G1C1	3.05e-76	785	1162	2	388	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q8RKJ2	3.66e-37	707	1162	126	604	Teichoic acid poly(ribitol-phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000086	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001296_01062.