CAZyme Information: MGYG000001296_01063

Basic Information

• Species: Pediococcus acidilactici
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Pediococcus; Pediococcus acidilactici
• CAZyme ID: MGYG000001296_01063
• CAZy Family: CBM50
• CAZyme Description: Vitamin B12 import ATP-binding protein BtuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000001296_1|CGC14	39501.08	9.2159

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001296	1929633	Isolate	not provided	not provided

• Gene Location: Start: 1052316; End: 1053380 Strand: -

Full Sequence      

MDYKIQVKNVTKEYDLYKSKSDRLKNFFNIKKTDVPHFWSLKGVSLDVKQGETLGIIGVN
GSGKSTISNIISGIIPQTTGMVDVKGDTSIISIGAGLKWNLTGLENIRLKGLMQGLSIKE
INDIRQDIIDFADIGSFINQPVKDYSTGMRSRLGFAIAVHINPDIIIIDEALSVGDATFY
QKCVDKIMEFKKQGKTIVFVSHALGQVEKICDTVAWMHYGELKDVGPAEKVIAEYRAFYA
DFKAMSAKEKKEYQATKKAEQLDFDVEAYQKELVEEKIAQGSKPAEAKKSVHNVLYKQVL
PEKMTLMTRLAVVILVLLMLGIGFSHIMGYSFFSLLENPARIFHKLAAGFIALL

Enzyme Prediction     

No EC number prediction in MGYG000001296_01063.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1134	TagH	1.11e-100	4	243	3	246	ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
PRK13545	tagH	2.94e-97	1	254	1	253	teichoic acids export protein ATP-binding subunit; Provisional
cd03220	ABC_KpsT_Wzt	2.60e-93	5	226	1	224	ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.
PRK13546	PRK13546	3.88e-91	1	254	1	253	teichoic acids export ABC transporter ATP-binding subunit TagH.
COG1131	CcmA	2.14e-42	29	279	9	272	ABC-type multidrug transport system, ATPase component [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBD25608.1	3.52e-105	2	346	4	347
AUC58829.1	3.52e-105	2	346	4	347
QPB60328.1	3.52e-105	2	346	4	347
AYZ07349.1	3.52e-105	2	346	4	347
QCJ67441.1	3.52e-105	2	346	4	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DD0_A	9.38e-103	1	269	1	267	Crystalstructure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],7DD0_B Crystal structure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],7DD0_C Crystal structure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],7DD0_D Crystal structure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]
6JBH_A	2.21e-88	1	253	1	252	Cryo-EMstructure and transport mechanism of a wall teichoic acid ABC transporter [Alicyclobacillus herbarius],6JBH_B Cryo-EM structure and transport mechanism of a wall teichoic acid ABC transporter [Alicyclobacillus herbarius]
6AMX_A	1.25e-60	5	235	1	231	CrystalStructure of Nucelotide Binding Domain of O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6AN5_A Crystal Structure of The Nucelotide Binding Domain of an O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6AN5_B Crystal Structure of The Nucelotide Binding Domain of an O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6OIH_A Crystal structure of O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6OIH_B Crystal structure of O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5]
6M96_A	3.75e-60	5	235	3	233	ATP-boundconformation of the WzmWzt O antigen ABC transporter [Aquifex aeolicus VF5]
7K2T_A	8.03e-59	5	252	3	244	ChainA, ABC transporter [Aquifex aeolicus VF5],7K2T_C Chain C, ABC transporter [Aquifex aeolicus VF5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q88ZH4	1.10e-162	3	344	5	347	Teichoic acids export ATP-binding protein TagH OS=Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) OX=220668 GN=tagH PE=3 SV=1
Q03SI5	4.76e-137	3	344	5	346	Teichoic acids export ATP-binding protein TagH OS=Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947) OX=387344 GN=tagH PE=3 SV=1
Q831L8	9.97e-106	2	346	4	347	Teichoic acids export ATP-binding protein TagH OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=tagH PE=3 SV=1
Q8Y843	1.30e-102	4	261	6	263	Teichoic acids export ATP-binding protein TagH OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=tagH PE=3 SV=1
Q720Z5	7.88e-102	4	253	6	255	Teichoic acids export ATP-binding protein TagH OS=Listeria monocytogenes serotype 4b (strain F2365) OX=265669 GN=tagH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
311	333