CAZyme Information: MGYG000001296_01410

Basic Information

• Species: Pediococcus acidilactici
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Pediococcus; Pediococcus acidilactici
• CAZyme ID: MGYG000001296_01410
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		40074.45	7.9244

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001296	1929633	Isolate	not provided	not provided

• Gene Location: Start: 1444812; End: 1445852 Strand: +

Full Sequence      

MYVTAIVPAHNEAGNIKRAVRALKKQVDKVIVVCDRCDDDTYQRAQQAGARAFETVQNEG
RKAGALNQALENYVDWQQPDQYLFICDADTVITEDWIEHAKRVIAQGDYDAVGSVFYGTA
NRNKLIEFCQQLEWYRYANQVRRSKKVFVLTGTASLIRAETLQKVRQQIGTFYREDSITE
DFALTLDLKAAGAKMISPLSCYCTTEIMPTWRLLYLQRRRWYLGALQQVTRRRWDKMMLP
YVFQQLMLLISVFAFLGLIVFTTYLMLENLMIFSLLWFVIGVIFATERVVTIWDQDFQAK
FFALMMLPELMYSLFLQLAYLGALLQLLQGSTGTWNHLNTDQSKEA

Enzyme Prediction     

No EC number prediction in MGYG000001296_01410.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	165	1.4e-19	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	4.02e-34	6	181	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.28e-28	3	316	56	384	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06438	EpsO_like	1.88e-21	6	184	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06421	CESA_CelA_like	9.72e-19	3	228	3	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
pfam00535	Glycos_transf_2	1.04e-15	4	160	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHM51920.1	2.03e-248	1	346	1	346
QHM53827.1	2.03e-248	1	346	1	346
QQP83449.1	2.03e-248	1	346	1	346
QHS02756.1	2.03e-248	1	346	1	346
QAT21592.1	1.66e-247	1	346	1	346

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
241	263
270	292
302	324