CAZyme Information: MGYG000001296_01540

Basic Information

• Species: Pediococcus acidilactici
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Pediococcus; Pediococcus acidilactici
• CAZyme ID: MGYG000001296_01540
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484	MGYG000001296_1|CGC29	55444.29	4.8797

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001296	1929633	Isolate	not provided	not provided

• Gene Location: Start: 1583919; End: 1585373 Strand: -

Full Sequence      

MKNQYSYFPKNFLWGGAQAASQADGAYRDDGKGLNSSDVQPFLKGLSNEEIQKIEVQGMT
LAQAKAGVTDQEHYYPKRYGIDFYHTYESDIDLLSEMGFKTFRTSLDWSRIFPNGDDEEP
NVAALEHYSKMIDYLLSKNIEPIITMNHYETPLNITFKYGGWPNKDVIPMFEKFGKTLLD
WFGDRVKYWIVVNQINMVQTEPWLSVGVAADQYDNLAEALYQSTHNQMVAAAWIKNYAKT
LNHPNLNIGTMVADGTVFPATAKPDDVVLALQHNRMQYMFTDVQFRGAYPKFAQNYFADH
DIKLAITDAEMKLIKENPMDFLGISYYYSQMVDSTKNKYEVNDTTPNPYLKASPWGWAID
PQGFYNTLSQYADRYGKPIIIAENGIGMYDELTEDKKVHDDYRVDYLRQHIEQVGRAIHD
GANVIAYCAWGPIDIVSCSSQQMSKRYGFIYVDLDDEGNGTGARYKKDSFTWYKKVIATN
GEEL

Enzyme Prediction     

No EC number prediction in MGYG000001296_01540.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	481	7.5e-131	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	4.77e-176	8	483	4	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	1.89e-159	6	484	2	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09589	celA	4.97e-152	6	484	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	1.74e-150	8	484	6	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	2.74e-142	8	484	6	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZP90314.1	0.0	1	484	1	484
QAT21164.1	0.0	1	484	1	484
QZQ47103.1	0.0	1	484	1	484
QHM54314.1	0.0	1	484	1	484
QOP74091.1	0.0	1	484	1	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	3.55e-152	1	484	1	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	9.29e-144	8	484	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F66_A	3.36e-134	3	484	2	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
3QOM_A	3.47e-134	8	484	11	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
4F79_A	9.52e-134	3	484	2	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	4.82e-152	1	484	1	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	6.13e-146	8	484	7	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q48409	3.38e-143	8	484	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P42973	8.56e-137	9	484	5	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P26206	1.13e-133	8	484	5	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001296_01540.