CAZyme Information: MGYG000001297_01734

Basic Information

• Species: Campylobacter_D coli
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_D; Campylobacter_D coli
• CAZyme ID: MGYG000001297_01734
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
181	MGYG000001297_2|CGC1	20569.31	8.3999

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001297	1678604	Isolate	not provided	not provided

• Gene Location: Start: 5347; End: 5892 Strand: -

Full Sequence      

MIDIALIEQCKNPNVETQIIQKIIQVESNNQQFAININKVGSFILKNKKEAENLANNFIK
GGYSVDIGLMQFNSNNLKSSTFSHYSVEDLLDTCKNIKAGSDIFYLAYEMTNKNLAKEDR
INQALSIYNTGDLKKGFSNGYVAKYDSTAKTIDDLEEKARKSDTRIKITYNLFNLQTQKK
E

Enzyme Prediction     

No EC number prediction in MGYG000001297_01734.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16892	LT_VirB1-like	1.05e-48	6	150	1	143	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK13864	PRK13864	3.11e-19	13	152	39	176	type IV secretion system lytic transglycosylase VirB1; Provisional
cd13400	LT_IagB-like	4.31e-09	14	110	2	75	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	2.24e-08	11	146	6	110	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16895	TraH-like	5.94e-08	2	104	1	104	conjugal transfer protein H and similar proteins. This subfamily consists of several TraH proteins, putative conjugal transfer proteins of uncharacterized function, apparently found only in alphaproteobacteria. They have similarity to lysozyme and preserve the critical glutamate residue which has catalytic activity in lysozyme-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALV00800.1	9.37e-124	1	181	1	181
APA58741.1	9.37e-124	1	181	1	181
AGZ22107.1	9.37e-124	1	181	1	181
APA62422.1	9.37e-124	1	181	1	181
AJW59148.1	9.37e-124	1	181	1	181

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P17791	4.91e-11	13	152	39	176	Protein virB1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=virB1 PE=3 SV=3
P0A3V6	8.78e-11	13	152	39	176	Protein virB1 OS=Rhizobium radiobacter OX=358 GN=virB1 PE=3 SV=1
P0A3V7	8.78e-11	13	152	39	176	Protein virB1 OS=Agrobacterium tumefaciens (strain 15955) OX=190386 GN=virB1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001297_01734.