CAZyme Information: MGYG000001298_00515

Basic Information

• Species: Listeria grayi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria grayi
• CAZyme ID: MGYG000001298_00515
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
273	MGYG000001298_1|CGC9	31469.81	9.7424

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001298	2589961	Isolate	not provided	Europe

• Gene Location: Start: 477071; End: 477892 Strand: +

Full Sequence      

MTIGILLFLILVGVIASFVRQQYLIITAPKPDPAYHTKEQNFINELSVHAQEIQAKHNIL
TSVTLAQAILESNWGESELASSANNLFGVKSTTSKPHVSMKTKEFEKGKWKEITANFRKY
RDWEESLDDHAALFLNGTSWHRDKYRSVITAKNYKQAAHALREAGYATDPGYTEKLIELV
EKYHLEKYDRISDKIYYNAKADRQAKVKAGVDETIWSRPYGLKGAQPLESTKYYQRDKLQ
ITREVKTDSGVWVQLHQKDKNIGWIQSKYLEKK

Enzyme Prediction     

No EC number prediction in MGYG000001298_00515.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	49	185	3.1e-37	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.54e-72	2	196	7	195	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	2.96e-35	42	200	323	485	amidase domain-containing protein.
smart00047	LYZ2	1.27e-32	40	189	9	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	3.28e-32	40	177	153	291	flagellar assembly peptidoglycan hydrolase FlgJ.
NF038016	sporang_Gsm	2.06e-30	14	189	135	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI34872.1	5.27e-196	1	273	1	273
CAK20589.1	3.34e-122	4	273	20	289
QUR87008.1	4.74e-122	4	273	20	289
QGF41844.1	4.74e-122	4	273	20	289
CAC96409.1	4.74e-122	4	273	20	289

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	4.32e-32	37	189	28	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	1.29e-20	40	182	4	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.86e-20	40	182	4	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	1.40e-19	40	189	61	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	4.59e-12	40	180	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	6.23e-64	38	271	47	277	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	7.09e-19	27	242	51	285	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P15931	9.11e-19	27	182	140	296	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
P75942	1.21e-18	42	195	152	301	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	1.21e-18	42	195	152	301	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.971851	0.027502	0.000178	0.000153	0.000083	0.000231

TMHMM  Annotations     

start	end
2	19