CAZyme Information: MGYG000001298_00516

Basic Information

• Species: Listeria grayi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria grayi
• CAZyme ID: MGYG000001298_00516
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276	MGYG000001298_1|CGC9	30735.4	10.2131

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001298	2589961	Isolate	not provided	Europe

• Gene Location: Start: 478123; End: 478953 Strand: +

Full Sequence      

MLKLVKKHIVILGISLSITMVACPVVSEARTTAENNKQESFINEIAPYAKKVQHEHHILS
SIIISQAILESNWGTSKLAKQGKNLFGIKGAFKGNAIYLPTKEFRKGNWIATNASFCVYP
SWYESLSSHGELLGKGPSWNRNLYKGLVNETNYKKAAAIIGKSAYSSDPDYTEKLISLIE
KFKLQQYDNDLVAEKQSRKNLVDFAGIFPRKSMLTTVQSDTQFAQAAKLGLTISSPLRFE
RNSVGRTQVTYKVTHPFQSSANLLVEASITNGMILR

Enzyme Prediction     

No EC number prediction in MGYG000001298_00516.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	46	184	1.2e-30	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	4.08e-62	2	189	7	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	2.39e-35	24	190	301	474	amidase domain-containing protein.
smart00047	LYZ2	9.70e-34	31	188	2	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK06347	PRK06347	1.92e-28	39	189	151	304	1,4-beta-N-acetylmuramoylhydrolase.
pfam01832	Glucosaminidase	5.68e-24	46	129	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI34870.1	4.68e-196	1	276	1	276
SNV22838.1	4.11e-72	1	210	1	211
CAK20590.1	4.11e-72	1	210	1	211
CBH27249.1	3.28e-71	1	188	1	190
AIS65148.1	4.64e-71	1	195	1	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.40e-30	38	188	30	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	5.80e-26	34	190	56	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	7.30e-15	39	183	4	149	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.00e-14	39	183	4	149	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	6.09e-11	39	186	2	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.45e-40	29	188	39	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q2G222	5.14e-25	34	267	316	563	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
Q9CIT4	1.85e-23	33	188	57	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P39046	3.90e-23	5	188	21	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
P0C2T5	4.69e-23	33	188	57	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000339	0.285089	0.714178	0.000135	0.000135	0.000115

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001298_00516.