CAZyme Information: MGYG000001298_00708

Basic Information

• Species: Listeria grayi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria grayi
• CAZyme ID: MGYG000001298_00708
• CAZy Family: PL9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437	MGYG000001298_1|CGC12	47919.28	10.6164

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001298	2589961	Isolate	not provided	Europe

• Gene Location: Start: 673842; End: 675155 Strand: +

Full Sequence      

MKNWMIVICIVLAGVIWGTIPNQAEAKKELFVSPSGSDNSKGTKNKPLKTISKAAKIAKK
GTVVTIKKGTYPEHIVLKNSGTKKEPIIFQAEKPNTVKITGKKKGNQEQLILINNKQYIQ
IKNIELTNFWTKKEDFTPIAIMVTGKSSHIRIEKTYIHDLGTKHKNGNAHGIAVYGNKPI
KDITLVKNKLAHLKLGYSEAMVLNGDVSTFKITDNTLTKNDNIGIDIIGGEGVSASKKTD
KARNGSILRNNVSYQSSKHNPAYKGEQAAGGIYIDGGENVLIKGNTSNNNDIGIEVASEH
KNKVAKDIRVLNNTVRQNNYTGIAVGGYDSSVGGIKNVVISGNILADNDKIGQEAGQLLI
QSHITQLKVTNNKLYNKKAGFFISQGEKQKIKAVLSGNKYYLRTGDKFLSTWQGKRITSF
SKFKKLTAETGKIIKRK

Enzyme Prediction     

No EC number prediction in MGYG000001298_00708.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL9	26	383	1.3e-127	0.9918478260869565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14592	Chondroitinas_B	1.42e-05	49	176	5	126	Chondroitinase B. This family includes chondroitinases. These enzymes cleave the glycosaminoglycan dermatan sulfate.
pfam13229	Beta_helix	6.21e-05	270	387	1	124	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
cd14251	PL-6	3.31e-04	53	177	9	126	Polysaccharide Lyase Family 6. Polysaccharide Lyase Family 6 is a family of beta-helical polysaccharide lyases. Members include alginate lyase (EC 4.2.2.3) and chondroitinase B (EC 4.2.2.19). Chondroitinase B is an enzyme that only cleaves the beta-(1,4)-linkage of dermatan sulfate (DS), leading to 4,5-unsaturated dermatan sulfate disaccharides as the product. DS is a highly sulfated, unbranched polysaccharide belonging to a family of glycosaminoglycans (GAGs) composed of alternating hexosamine (gluco- or galactosamine) and uronic acid (D-glucuronic or L-iduronic acid) moieties. DS contains alternating 1,4-beta-D-galactosamine (GalNac) and 1,3-alpha-L-iduronic acid units. The related chondroitin sulfate (CS) contains alternating GalNac and 1,3-beta-D-glucuronic acid units. Alginate lyases (known as either mannuronate (EC 4.2.2.3) or guluronate lyases (EC 4.2.2.11) catalyze the degradation of alginate, a copolymer of alpha-L-guluronate and its C5 epimer beta-D-mannuronate.
pfam07602	DUF1565	4.59e-04	35	73	2	40	Protein of unknown function (DUF1565). These proteins share a region of homology in their N termini, and are found in several phylogenetically diverse bacteria and in the archaeon Methanosarcina acetivorans. Some of these proteins also contain characterized domains such as pfam00395 and pfam03422.
pfam05048	NosD	0.001	271	392	43	145	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI34444.1	9.69e-309	1	437	1	437
QQZ08892.1	2.07e-106	14	425	13	429
QQX26083.1	8.25e-106	14	427	13	431
APT52379.1	7.93e-103	23	423	27	436
APT51350.1	7.93e-103	23	423	27	436

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94576	2.08e-75	1	427	1	434	Uncharacterized protein YwoF OS=Bacillus subtilis (strain 168) OX=224308 GN=ywoF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000271	0.999053	0.000205	0.000152	0.000154	0.000143

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001298_00708.