CAZyme Information: MGYG000001298_01398

Basic Information

• Species: Listeria grayi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria grayi
• CAZyme ID: MGYG000001298_01398
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	MGYG000001298_1|CGC20	39531.69	9.4638

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001298	2589961	Isolate	not provided	Europe

• Gene Location: Start: 1378381; End: 1379448 Strand: +

Full Sequence      

MGILLFLLLAQFAFIYWNKRNIMDFYENQPFEELGISILIPARNEARNISKLLESLETQL
GPQDEVLIYDDQSTDATSEIASKYTCRILHGQTLPTGWTGKNFACYNLAAAAQNEWLLFL
DADVVLKEAGLRKIKAAVGQKKTKFVFFSGFPQQKTKDLLSFLLVPMMKFIIFSHLPLRY
ISQSANPLFAVACGQFILTSRKVYMEAGGHEAIKGSMLDDVALVKQVKKAGFPVAFVDIE
ALAACQMYNSPSEVMAGFQKNLFAGMGFRFSVLVPMSIWYLGLYILPWILLVAGMVSGDI
LLPFSTVIVSLAIGILVHKSVKKGLALPLSVGLALFVAYKSAFQTEMKWKGRSYK

Enzyme Prediction     

No EC number prediction in MGYG000001298_01398.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	37	204	1.1e-18	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04192	GT_2_like_e	4.20e-20	38	237	1	201	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02522	GT_2_like_a	3.88e-19	36	231	1	173	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02511	Beta4Glucosyltransferase	2.45e-18	36	138	2	96	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
cd00761	Glyco_tranf_GTA_type	1.73e-16	38	126	1	90	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	3.23e-16	36	137	5	107	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI36809.1	3.50e-249	1	355	1	355
QGG58267.1	7.69e-68	18	354	62	422
AWI37815.1	1.65e-67	7	355	11	375
QLI77228.1	2.33e-67	7	355	11	375
QZD60781.1	3.28e-67	7	355	11	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TZE_C	4.75e-06	34	158	1	135	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	6.18e-06	34	158	1	135	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4L977	1.17e-14	13	265	19	272	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=crtQ PE=3 SV=1
Q7A3E0	7.49e-13	17	267	23	271	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain N315) OX=158879 GN=crtQ PE=1 SV=1
Q6G6B1	7.49e-13	17	267	23	271	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=crtQ PE=3 SV=1
Q5HCY7	7.49e-13	17	267	23	271	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain COL) OX=93062 GN=crtQ PE=3 SV=2
Q8NUQ4	7.49e-13	17	267	23	271	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=crtQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995001	0.004475	0.000476	0.000020	0.000011	0.000036

TMHMM  Annotations     

start	end
272	294
301	318
324	343