CAZyme Information: MGYG000001298_01628

Basic Information

• Species: Listeria grayi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria grayi
• CAZyme ID: MGYG000001298_01628
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MGYG000001298_2|CGC2	54732.76	4.7849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001298	2589961	Isolate	not provided	Europe

• Gene Location: Start: 109572; End: 111017 Strand: +

Full Sequence      

MRAAFTMPEDFLWGGAIAANQAEGAYKVDGKGISLADLHKYYPEKSNEEISAAQHQGMSV
AEVKANLADETGYYPKRHGIDFYHTYPEDLALLSEMGFKTFRTSIDWTRIFPTGEETEPN
EAGLAYYDRLIDKIIELGMEPIITILHYETPVSITLKYGGWNNRAVIDLFVKYGKVVLDR
YKKKVKYWIAINQINLIQFEPFNSTAVAYDTVDNYEEASFQAVHHQFVASAQLVQYAKAI
NPEIQMGTMVADCTAYPFSCKPDDIILALKRNRMQYFYTDVQFRGEYPQYALNYFASKSI
ELSITEADKELLKNNTMDYLAISYYYSQMVDSSKNDLNPASVTANPNLTANPWGWAVDPQ
GLYNSLSQYWDRYQKAIIIAENGFGMYDKLEDGSVHDDYRIAYLSEHIKQMKNAMADGVD
VIAYCAWGPIDIVSCSSAQMEKRYGFIYVDLDNEGNGSGKRIKKDSFEWYKKVIASNGEV
L

Enzyme Prediction     

No EC number prediction in MGYG000001298_01628.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	478	6.6e-137	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	6	481	3	476	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	0.0	6	480	3	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	7.04e-174	6	481	3	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	2.01e-169	6	481	5	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	3.30e-166	5	481	4	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI31338.1	0.0	1	481	1	481
QCQ15144.1	1.41e-315	7	481	1	475
AYQ23908.1	9.83e-315	5	481	4	480
QNP37667.1	4.15e-314	5	479	5	479
QIJ69271.1	1.69e-313	5	479	5	479

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.25e-169	8	481	9	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	3.80e-156	7	479	7	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.08e-155	7	479	7	478	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
2XHY_A	3.89e-153	6	481	7	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3PN8_A	9.24e-152	7	479	7	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	5.17e-166	8	481	9	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	5.40e-158	7	481	4	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	2.13e-152	6	481	7	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q48409	5.20e-152	6	478	3	459	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P26206	1.75e-150	8	481	6	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000094	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001298_01628.