CAZyme Information: MGYG000001298_01810

Basic Information

• Species: Listeria grayi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria grayi
• CAZyme ID: MGYG000001298_01810
• CAZy Family: GH46
• CAZyme Description: Chitosanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281	MGYG000001298_2|CGC7	31665.92	10.3167

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001298	2589961	Isolate	not provided	Europe

• Gene Location: Start: 302042; End: 302887 Strand: +

Full Sequence      

MDKRLKFSSIIVILSIIVSVICYFVFGDQETEATAKKSAVSLKTAAKKEIAMELVSSAEN
SSLKWKKQYAYIEDIKDGRGYTAGIIGFCSGTGDMLQLVESYTKMKPQNVLKKYLPALKK
VNGTASHKGLGKAFEKDWKKAAKDKTFQKAQNNLRDKVYFDPAVKQAKKDGLRTLGQFVY
YDAIVMHGPDDGSVPHPESFYGIREAALKHAKTPAKGGNEAKYLEAFFKARVKVMRLEAA
HEDISRVTAQRKFLKEKKYDLQTPLKWKMYGTPFVIKKEPK

Enzyme Prediction     

EC	3.2.1.132

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH46	44	261	5.7e-87	0.9819819819819819

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01374	Glyco_hydro_46	4.30e-127	53	265	1	210	Glycosyl hydrolase family 46. This family are chitosanase enzymes.
cd00978	chitosanase_GH46	3.23e-102	45	265	1	222	chitosanase belonging to the glycosyl hydrolase 46 family. This family is composed of the chitosanase enzymes which hydrolyzes chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Chitosanases play a role in defense against pathogens such as fungi and are found in microorganisms, fungi, viruses, and plants. Microbial chitosanases can be divided into 3 subclasses based on the specificity of the cleavage positions for partial acetylated chitosan. Subclass I chitosanases such as N174 can split GlcN-GlcN and GlcNAc-GlcN linkages, whereas subclass II chitosanases such as Bacillus sp. no. 7-M can cleave only GlcN-GlcN linkages. Subclass III chitosanases such as MH-K1 chitosanase are the most versatile and can split both GlcN-GlcN and GlcN-GlcNAc linkages.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI31890.1	3.42e-196	1	281	1	281
SEU06030.1	3.72e-116	6	278	4	278
QRV22162.1	2.00e-112	37	278	2	243
ADL03075.1	6.67e-112	37	278	37	278
SDT79824.1	7.08e-107	33	276	37	277

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CHK_A	1.62e-104	47	276	10	236	StreptomycesN174 Chitosanase Ph5.5 298k [Streptomyces sp. N174],1CHK_B Streptomyces N174 Chitosanase Ph5.5 298k [Streptomyces sp. N174]
4ILY_A	7.24e-94	38	276	14	249	Abundantlysecreted chitosanase from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E],4ILY_B Abundantly secreted chitosanase from Streptomyces sp. SirexAA-E [Streptomyces sp. SirexAA-E]
4OLT_A	1.80e-81	40	276	14	247	Chitosanasecomplex structure [Pseudomonas sp. LL2(2010)],4OLT_B Chitosanase complex structure [Pseudomonas sp. LL2(2010)]
4QWP_A	2.93e-80	40	276	14	247	co-crystalstructure of chitosanase OU01 with substrate [Pseudomonas sp. A-01],4QWP_B co-crystal structure of chitosanase OU01 with substrate [Pseudomonas sp. A-01]
7C6C_A	5.56e-38	51	277	11	242	ChainA, Chitosanase [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33665	1.29e-105	27	276	29	276	Chitosanase OS=Streptomyces sp. (strain N174) OX=69019 GN=csn PE=1 SV=1
P48846	7.51e-100	38	276	42	276	Chitosanase OS=Nocardioides sp. (strain N106) OX=47919 GN=csn PE=3 SV=1
O07921	7.33e-37	51	277	46	277	Chitosanase OS=Bacillus subtilis (strain 168) OX=224308 GN=csn PE=1 SV=1
P33673	1.26e-06	52	193	72	225	Chitosanase OS=Niallia circulans OX=1397 GN=csn PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.724315	0.025457	0.235518	0.000201	0.000141	0.014385

TMHMM  Annotations     

start	end
5	27