CAZyme Information: MGYG000001298_02589

Basic Information

• Species: Listeria grayi
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Listeriaceae; Listeria; Listeria grayi
• CAZyme ID: MGYG000001298_02589
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000001298_4|CGC1	39060.24	6.7607

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001298	2589961	Isolate	not provided	Europe

• Gene Location: Start: 37301; End: 38386 Strand: +

Full Sequence      

MSNLARIWLKRTLWGLVFSVPGLILFGVVAISIIIGVLVADDQAKKNATTGAEMSDVGAE
EIPKDYIEIYQAAEKKYGVPWTLLAAHHKVETNFSVDLNVSSAGAIGPMQFMPLTWLGWN
YPGGSRLGNASIPDAIISSPKMIAKYGGYGVDGDGDGKADPWNLTDSVFAAANYLAANGA
ANGNYQQAVFAYNHSDQYVNAVLDWFDKYTKNKDALLSGGDTVVGGNKIIERAIQTGMTI
LNKSPYNWGGGRTQADIDARSFDCSSFVRWAFSGADVDLGPIASTTTDTLVIKGKAVSVM
KMERGDLLFFDTYKRNGHVGIYLGNGKFLNDNSSHGVSIDSLDNSYWKGVFHGTVRRIII
K

Enzyme Prediction     

No EC number prediction in MGYG000001298_02589.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	75	213	3.4e-20	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00877	NLPC_P60	2.65e-32	245	356	3	105	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
cd13399	Slt35-like	2.51e-24	77	208	1	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG0791	Spr	2.52e-21	166	353	15	195	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
PRK10838	spr	1.70e-15	250	359	85	185	bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase.
NF033742	NlpC_p60_RipB	3.04e-14	215	336	62	184	NlpC/P60 family peptidoglycan endopeptidase RipB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGT06905.1	7.01e-268	1	361	1	361
AWW22405.1	7.90e-247	29	361	2	334
QAT55802.1	3.34e-150	2	359	13	380
ASK26302.1	9.52e-150	2	359	13	380
QSF36411.1	1.67e-142	34	358	27	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2K1G_A	7.76e-10	250	359	24	124	SolutionNMR structure of lipoprotein spr from Escherichia coli K12. Northeast Structural Genomics target ER541-37-162 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40767	1.10e-55	230	359	343	472	Peptidoglycan DL-endopeptidase CwlO OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlO PE=1 SV=2
Q65NQ9	1.92e-55	218	359	312	451	Peptidoglycan DL-endopeptidase CwlO OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=cwlO PE=3 SV=1
O07532	8.59e-12	245	356	387	486	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
P54421	1.61e-11	244	356	233	333	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
P45296	7.70e-11	244	347	73	172	Probable endopeptidase NlpC homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nlpC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35