CAZyme Information: MGYG000001299_01184

Basic Information

• Species: Amedibacillus dolichus
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Amedibacillus; Amedibacillus dolichus
• CAZyme ID: MGYG000001299_01184
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1054		116972.85	4.9606

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001299	2190453	Isolate	not provided	not provided

• Gene Location: Start: 240506; End: 243670 Strand: +

Full Sequence      

MNFKKTTSKQTEKKAKKAIKHKKRRLSVLDRIVIVFLTIALLCGAGGLSVIGYIIATTDT
DNLISQMNNTEPSTFLDQNGEEFAELGLESRENVSYQQVPQSVIDAFLAIEDSRFYKHNG
FDLPRFISSALTNLKSGSLAQGGSTLTMQTIDNFFIKKQEQELEEQGIQQNTLQKIESKM
REIYMSMRIEQELSKAEIMERYLNQINFGNKARGIQRGAQYFFGKDVEDLNLSEAAYLAG
CINAPNTFNPYNGYSSSGIGIGNFSKLTTVISTYSQLSSDGYTQESWNAFVQALDRAKRL
AEKESESQATYADGLAALQAAYEGLAKSDASADLVRLQQSVNMYATFTNNAGSSFSDESW
QTYAIASEEANQLVVDNSTNQEAVTAALKKLNHAFTALSPIKFNYYEAATKRRDETLYMM
KYHGYISQTEYELAKSTQLAFQVVGESASAQDPYDNYLKAVTKEVMELTGLDPATTPMVV
HTYLDKEAQLAANEAAEGKVVSLDTNKNYQIATSVIDNKTGGIVAMIPGRSDYESEFYRN
RADDQERMPGSSVKPIFDYAYALDHLGYCTSRVYNDKKMTVDGTVIRNSDGKYYGKVSME
RALAQSLNTPAMKTMEDILNRGYEQDMKEYLQKLGFSKEQADQFNIRYALGGSLSTSPRQ
MAGAFSALANQGIVKETHYVRSIEFKDGKKDPITVTPKETQAMSPQAAYMTSELLYKAVH
GKYQGWNLMGRLGWSIPVYGKTGTSDWASDGLDRGIPETAMRDEWMINYTSEYTIATWSG
FDQEVADGNNYVTEQLLLENIPGWINKHILETISKNPQKIQNPGGIASYGGGMIKQEFLK
DAAKNNPMTEANQTQEMDKLQALYDQVKGYQAADYTAESFAAFQSVLEEVARMLDEDTAS
DDEVYAAITKLQNAVNNLVKTVHKDTLLSVINQAAALNPNEYTADSYRFLASVVEEAREI
YQNPNASQAEINSAVNQVQNAIQALVKKSSQASKGALANAINIARRKAAEWSVSDPNRAN
RLRQLIASAQSVYNNPNASQAEVDAQTNALYAAM

Enzyme Prediction     

No EC number prediction in MGYG000001299_01184.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	80	253	5.1e-54	0.8983050847457628

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	4.21e-114	29	793	11	580	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	1.63e-109	91	783	2	503	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	2.07e-89	31	783	3	693	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	2.71e-61	79	254	1	162	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG4953	PbpC	5.51e-45	75	784	39	539	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA02651.1	2.36e-254	24	1054	251	1135
ANU69517.1	6.29e-254	24	1054	295	1179
QQR26596.1	6.29e-254	24	1054	295	1179
ASU18050.1	6.29e-254	24	1054	295	1179
QIX09370.1	8.87e-254	24	1054	295	1179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	9.32e-62	72	846	7	618	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	2.57e-57	65	846	9	627	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
7U4H_A	4.86e-42	65	880	11	836	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
2V2F_F	2.14e-36	447	835	1	386	Crystalstructure of PBP1a from drug-resistant strain 5204 from Streptococcus pneumoniae [Streptococcus pneumoniae]
4OON_A	1.12e-35	72	828	20	739	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	1.18e-66	20	795	24	628	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q00573	6.06e-57	65	785	45	604	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
Q04707	1.28e-52	65	835	45	649	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q8DR59	3.11e-52	65	835	45	649	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
P38050	1.73e-44	73	792	49	579	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995164	0.003562	0.000044	0.000018	0.000009	0.001217

TMHMM  Annotations     

start	end
32	54