CAZyme Information: MGYG000001300_00362

Basic Information

• Species: Faecalibacterium prausnitzii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii
• CAZyme ID: MGYG000001300_00362
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221	MGYG000001300_1|CGC3	25576.2	7.2739

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001300	3126983	Isolate	not provided	not provided

• Gene Location: Start: 382918; End: 383583 Strand: -

Full Sequence      

MNEQNYEKAYDPIAARERRAAREKQRLRKQQRRRQLVLRLAALCLAVVLTVCAVPPLCNR
AEQLLYPRKYEQLVEKWAAAYELDPLLVYAFIRTESGFDPQATSSVDARGLMQMTEETFL
WMRSKIAPEEPLTFADLYDPDTAIRFGCYYLHLCMVRYKGDVSTAAAAYHSGWGTVDQLL
QIEEHSADGETLQGFPYNQMHHYVNKITACYQTYQRLYAGQ

Enzyme Prediction     

No EC number prediction in MGYG000001300_00362.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	83	215	3.9e-28	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.09e-53	67	212	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.09e-33	65	217	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.40e-27	85	212	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	9.68e-25	76	176	3	99	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	1.79e-22	49	176	118	244	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXB28497.1	2.93e-133	1	221	1	221
AXA80758.1	2.01e-97	46	220	22	194
CBK98413.1	4.04e-97	35	220	9	194
ATL89088.1	4.75e-92	53	220	20	187
ATO98725.1	1.11e-90	53	220	20	187

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	1.89e-09	66	220	449	603	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	3.44e-09	66	220	449	603	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
5MPQ_A	8.27e-09	64	220	410	561	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	8.29e-09	64	220	414	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	8.31e-09	64	220	420	571	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	2.45e-13	71	211	61	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	1.25e-11	66	211	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	1.25e-11	66	211	1418	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
A9R6R2	3.28e-09	69	216	190	357	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Angola) OX=349746 GN=mltC PE=3 SV=1
Q8ZHE6	3.28e-09	69	216	190	357	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis OX=632 GN=mltC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.994011	0.004993	0.000363	0.000050	0.000023	0.000546

TMHMM  Annotations     

start	end
36	58