CAZyme Information: MGYG000001300_01841

Basic Information

• Species: Faecalibacterium prausnitzii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii
• CAZyme ID: MGYG000001300_01841
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805		85553.62	5.7443

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001300	3126983	Isolate	not provided	not provided

• Gene Location: Start: 52774; End: 55191 Strand: +

Full Sequence      

MKHTDIIKSLSLEQKCALLSGGTVFTTRALPGKGIPAITLSDGPNGVRKQAGAADHLGLN
PSVPATCFPTSATVANSWDPALGEAVGAAMGEEAAAQGVSVLLGPGLNIKRSPLCGRNFE
YFSEDPYLAGKMAAAYVRGIQKNGIAACPKHFAVNSQELRRMASDSIVDERTLREIYLTG
FEMVVKEAQPKTIMSAYNLVNGTYANENTHLLMDILRGDWGFDGAVVTDWGGSNDHALGV
KNGSTLEMPAPGGDAVRELMKAVQTGKITEADVDARLDELLELVFTTKAAVDAAPGKFDA
DAHHALARRAAAQSIVLLKNENGLLPLAKGEKVAVIGDFAQTPRYQGAGSSAVNSIKVDS
FLECLAESGLNSVGYAKGFDRQGKPDEALKAEAVVLAKNANVVLLCMGLDEIKESEGIDR
ADMKLAENQLELLAAVAAANPNVVVLLSAGSSLESGWVKDCKALVYGCLGGQAGAGALVE
VLTGAQNPCGKLAETWARSYADTPAKAHFGGDGPTVEYREGLYVGYRYYDTAGVPTAFPF
GYGLSYTSFAYSDLKADENGVTLTVTNTGSCAGAEVVQLYVAKPDATIFRPVKELKGFTK
VQLEAGESKTVTIPLDDKAFRYWNVKTDRWEVEGGSYQLLVGASSADIRLTAAVTVAGTG
APDPYAGKDLAHYRTAQVQNVPDAEFEALLGRPIPENKVHIDRNMTLGEMGHGRSPIGWL
AAAVLGTLLRRSIKKGKPDLNILFQYNMPLRALSKMTNGAISMGMVDGIVMELQGFWIIG
LVRVIVEAVKNLVLNSRMEERLKNS

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	237	9.1e-67	0.9120370370370371

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.39e-78	66	649	118	758	beta-glucosidase BglX.
COG1472	BglX	1.24e-53	31	340	56	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.45e-50	6	616	56	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	3.63e-46	315	526	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam14310	Fn3-like	2.60e-33	575	645	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL01314.1	0.0	1	805	1	805
AXB27517.1	0.0	1	805	1	805
AXA81990.1	0.0	1	805	1	807
CBK98877.1	0.0	1	805	1	807
QOY61156.1	0.0	1	802	1	802

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	6.54e-200	6	659	8	671	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.32e-183	7	699	9	724	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.23e-122	2	656	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	6.36e-121	2	656	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.54e-111	5	648	8	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	3.58e-199	6	659	8	671	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	1.39e-187	7	711	9	741	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	1.96e-187	7	664	9	680	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
A7LXS8	9.69e-125	5	651	48	740	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P27034	1.21e-123	5	654	4	808	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997771	0.002235	0.000019	0.000004	0.000002	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001300_01841.