CAZyme Information: MGYG000001300_02529

Basic Information

• Species: Faecalibacterium prausnitzii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii
• CAZyme ID: MGYG000001300_02529
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
284	MGYG000001300_22|CGC1	29836.31	10.5189

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001300	3126983	Isolate	not provided	not provided

• Gene Location: Start: 47; End: 901 Strand: -

Full Sequence      

MKSVAQTVIEADRFYTIAAHTGNVIQAVEGSKDGGTVRLGKYDHKPEQEWSFVREGDGVY
RIRNRASGKLLDLTMTGTANGTWLHLWEDVGGTSQMWKVEHTPEGTVRLRSSWAGGKCVD
TVGIGAEVGAVLQIWQEVPGGGDQLWVISEVKDRVKRAAKVEQAAPAAETKAAPAKEAAP
AKKPAARKPRTAKKVEEKPATPAAKAAEPVKAEKPAAKKAAKAKAEPAAPAVEVKAAPAV
ATKAEPVTKAEPAAKAAPAAEAKTAPAAAKPKAKRAPCKKTVKK

Enzyme Prediction     

No EC number prediction in MGYG000001300_02529.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	13	158	2.6e-22	0.7287234042553191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14200	RicinB_lectin_2	1.25e-22	46	135	1	89	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	7.64e-15	15	87	15	89	Ricin-type beta-trefoil lectin domain-like.
pfam00652	Ricin_B_lectin	5.19e-09	59	155	2	91	Ricin-type beta-trefoil lectin domain.
cd00161	RICIN	4.50e-08	28	98	57	123	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
NF035929	lectin_1	9.54e-08	27	146	727	834	lectin. Lectins are important adhesin proteins, which bind carbohydrate structures on host cell surface. The carbohydrate specificity of diverse lectins to a large extent dictates bacteria tissue tropism by mediating specific attachment to unique host sites expressing the corresponding carbohydrate receptor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL01046.1	2.33e-119	1	200	1	200
AXB28205.1	2.82e-118	1	200	1	200
CBK97866.1	1.52e-65	1	162	30	190
AXA82809.1	1.52e-65	1	162	30	190
ATO98528.1	6.41e-64	1	158	1	157

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001300_02529.