CAZyme Information: MGYG000001304_00025

Basic Information

• Species: Erysipelatoclostridium spiroforme
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Erysipelatoclostridium; Erysipelatoclostridium spiroforme
• CAZyme ID: MGYG000001304_00025
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1363	MGYG000001304_1|CGC1	149430.14	4.2412

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001304	2507485	Isolate	not provided	North America

• Gene Location: Start: 34088; End: 38179 Strand: -

Full Sequence      

MKSKAGKILKSTLAASFAFSLVTANPVQILAAPQESSDVKVDVYPKPQEITYTSGEGMSL
VGEVNVVIHGEQESATLPKLEKILKENGISYTISDKVDNSKANILISSTSEHCDECAENL
GGNIGALSEEQGYILSANNDTNEKGEIKIVGADSDGAYYGLMTLTQMLEQKTKDNKIAET
VISDYPSVKLRGFVEGFYGYPWSFEDRLSLMSESSDFKMNTYIYAPKDDPYHKDQWRELY
PDDKAEELRQLAAEGKKDNMNFCWSVHPGNGFNYSTDADYNALINKFEQLYNLGVRQFGI
SYDDLGGYVNGQQHADLINRVNREWVKVKGDVDPLIVVGTRYCNGWGPSMTSYFKPFFST
LDDDVVVMWTGANTMSAITKDAYEWPKNQTGVTDKNLAAWWNYPVNDYCDGNLMMSPLEN
LDNDVDNLSGFFLNPMSQAEASKVAIFSGADYSWNIGGFERTSSWVRAIDELVPEASESF
QRFADNISYIKDGFEFDESRYLVDTIEAFKAALQNKEGIVEAATALKDEFTRMDNDVDAL
RNIEDKNLYEEIEQHLNAYEAVAKAGISSMQAFIDAENGDVDACLSNINTTEIKLKEAET
YKVESLESNGTKMNVVKVCEKRIKPLLKDSVDQIKSNLMDNVFPQTQATVIGTMSGLADK
TVELTKGNYQVSSIIGTMKANETVGIALPKAMRVSNVSITGNNLESLKVQTSINGIVWED
VEGAIEDGTLKATVDATATCVRVVNKTTASIDVTIDNIVVAPVYNTGTKTVETDLGTYGN
NVIANALDGNINTKFYSSAGATVGSYVRVDLGKEIPLYDTAIYYAGNPKGPSHGIDGFAA
TKMEISTDGVSWTQIGDIIKDENYQSKTVEGQLVSEAAFNADGQMARYIRFSATESSDNW
VQVFEIPFNKTVDNLGDDSIDIIDTTITTGNVSNLYDRDLTSAFAPDSVVDEDTLTYAMT
SITNVGRLMIMQDPTSICNATVSVKDVEGNWSDIGILDKGTNTFDVNKTILEVKLTFHAN
NPTPSIYEIIASQKEVEEVNKTALKVAVDKANAVTDEALINVIPVVVEEFKAARDEANAI
YNNENATQTEVDNAVARLVEVMQKLEFYKGDKTTLKIALDLATTITDEDLANVVPVVVEE
FKAALQQAKDVYDNVNATQADVNNAFDRLAEAMHMLNFVKGDKTALKAFIDKVSGLEAVK
YTEATWTPFNDALTAATSVYEDVNAMQEEVNNAYNELVTAFLNLRLIPNKDLLGDLINQA
EGLESANYTKATFDGLTKALNEAKVVFDNPNATQKEVDNAKDVLAKAMADLQTVTVDNTV
KTPVSNGDTTASVKTGDDVNMLGTLGLISSLGAIAFLKKKKRN

Enzyme Prediction     

No EC number prediction in MGYG000001304_00025.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	191	484	1.4e-103	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.27e-131	191	483	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	6.01e-14	42	184	3	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	4.16e-11	778	906	9	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	1.15e-04	784	906	26	141	Substituted updates: Jan 31, 2002
pfam07554	FIVAR	0.003	1042	1106	1	69	FIVAR domain. This domain is found in a wide variety of contexts, but mostly occurring in cell wall associated proteins. A lack of conserved catalytic residues suggests that it is a binding domain. From context, possible substrates are hyaluronate or fibronectin (personal obs: C Yeats). This is further evidenced by. Possibly the exact substrate is N-acetyl glucosamine. Finding it in the same protein as pfam05089 further supports this proposal. It is found in the C-terminal part of Bacillus sp. Gellan lyase, which is removed during maturation. Some of the proteins it is found in are involved in methicillin resistance. The name FIVAR derives from Found In Various Architectures.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE33733.1	0.0	1	1311	1	1239
ATD57955.1	0.0	1	1363	1	1319
SLK13973.1	0.0	1	1363	1	1319
QBJ74644.1	0.0	1	1363	1	1319
QAS61890.1	0.0	1	1311	1	1239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PV5_A	9.76e-98	41	595	40	596	Structureof CpGH84B [Clostridium perfringens ATCC 13124]
5OXD_A	8.81e-95	34	598	9	569	Complexof a C. perfringens O-GlcNAcase with a fragment hit [Clostridium perfringens]
2J62_A	9.81e-95	34	598	7	567	Structureof a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2J62_B Structure of a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2WB5_A GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens],2WB5_B GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens]
2YDQ_A	4.31e-94	34	598	9	569	CpOGAD298N in complex with hOGA-derived O-GlcNAc peptide [Clostridium perfringens],2YDR_A CpOGA D298N in complex with p53-derived O-GlcNAc peptide [Clostridium perfringens],2YDS_A CpOGA D298N in complex with TAB1-derived O-GlcNAc peptide [Clostridium perfringens]
6RHE_A	4.55e-94	34	598	9	569	CpOGAD298N in complex with hOGA-derived S-GlcNAc peptide [Clostridium perfringens ATCC 13124]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TR53	1.88e-90	7	598	4	597	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	1.19e-89	7	598	4	597	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q89ZI2	1.98e-82	41	627	24	586	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
P26831	1.03e-73	1	936	1	958	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	1.59e-26	190	461	61	341	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000338	0.998851	0.000199	0.000234	0.000198	0.000164

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001304_00025.