CAZyme Information: MGYG000001304_00203

Basic Information

• Species: Erysipelatoclostridium spiroforme
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Erysipelatoclostridium; Erysipelatoclostridium spiroforme
• CAZyme ID: MGYG000001304_00203
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2169	MGYG000001304_1|CGC5	238397.95	4.2439

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001304	2507485	Isolate	not provided	North America

• Gene Location: Start: 247428; End: 253937 Strand: -

Full Sequence      

MGFRERGYKMNKKTFHKISVWSLAAMMSLSTISTTTIGLSAKNALNDQISTLEVDEAGYN
VLGAVTSAVVDGNKVDLTIRTGEKIRFTFLEQNVFRMYMAPEGEEFQEYPTPNGSDHTAT
ITNKTDDQYKAEYDVVPELTDDGDKYTISTDKIKLEIVKETSLMKLMKADGTVVWEEAAP
LKYKSGSTVQTLKTNEKEYFFGGGTQNGYFSHKGKSIKIVATNTWVDGSVASPNPFYWST
DGYGVVRNTWKPGQYDFDSKGDGTVTTTHNEKRFDAYYFVDDSAEDILGDYYELTGTPAE
LPEYASYLGHLNCYNRDYWLEVPEGTSGAVKLGDKWYKESQSDNGGVKETLLGGNTTAQQ
VIEDHKANDMPLGWFAPNDGYGCGYGQADTQAGDIDNLKNFADFAKANGVETGLWTQSNL
WPADPSNPQKGERDIYKEVEAGVHATKTDVAWVGPAYSFALNGVSVAYDAIASRSGLKPA
IVTLDGWAGTQRYGGIWTGDQSGGNWEYIRFHIPTYIGTALSGQPNVGSDMDGIFGGSNK
IINTRDFQWKAFSTYMLDMDGWGSNQKTPWALGEDVTSINRTYLKLKAQLMPYINTISHE
ATAEGGLPMIRAMFLEEENAYTLGTATQYQYMWGDNFLVAPIYQNTAADAEGNDVRNDIY
LPGTSDVWIDYFTGKQYRGGQVLNNFDAPIWKLPLFVKNGSIIPMYAENNNPEAVSETNT
DGLDRSQRIVEFYPYGSTQFEAYEDDGKTLGGASSKTLLTSDVKDGIATLKAEKSVGSYS
GMVKERSTEFVVNASKAPTKVTGNVAGKDVVFTAVSTQEEYDAAKGNVYFYNENPSVIVK
DYATEGTKYANIEETTTPKLYVKSAEKVDITEYDFTVNVEGFENTQDLGEDIEDSSVAVP
TNFVEQSKTDSEIILDWDDMEDAVSYDIEVDGTVYRNILDSTYTHSGLKYLTDHTYRVRA
VRADGHYSAWSQPLNIQTDDNPYRNVPNFTADWSYGDSWGDLEDAFDHNTNTMFHSTKAV
TPDQMMTLDLGAAYQLDKLTYQPRMDNKGNGTVTRMDVYASLDGINYTKVWDGKENAAWT
YSSSMEDPDIKEVTLNGVKARYLKLSVLESKGGFFSASEITPYKLDGTNAWVVGDVNNSG
KVDNNDLTFYENYVGLKPVDNDWEYSTLGNIDNNQIIDAYDISFVSRMLGDEPVNPSQAA
KGVEGKIEIVPSKTDIKAGDEVTLDFYGIGLKNVNAFSVEMPVDTDLFEVTNFGSASLST
VFMRNFSKTRFHNDGSVDNYVCFANEGTQELINGTGSLAKVTIRATQDFNWDTKATQAIV
VGQDLSKADALIDITQEPTAPETKDVLGLNDIKAITFDNDKKQGMDGSELWQQSNWKELL
FDGDKSGTLAEFKWYLNTYPEAGDIAEEVKLPTDMNFTFNEAEPLKTIKVYNRVGGNGSV
TSIKATAYAGDTEYDLGTINENREVFEFTVPKEATNIDRVVITPLTSTGTATGTTTGSET
NRMLSLREIEFETDSAVKATGIEFTKDSADSVYTGAIAEVSAVVTPDNASNPFYEITSSD
ETIAKVIKIPMEDKYIYAVQGIKEGTVTLTATSEDGQFTATKEFKVVEGVDTSVLQGQID
KFEDLYENLYTVESYAKVKGLVTSAKELISSKDVTQAAVDKITIDIVNAMKELEFKGSNT
DQPSSQNLIPQNTLKRYDESSMSAAEKEDASYTIDGKTDTIWHSNYNSSYKLPQYVTIDL
GAVYDLEQVNMLPRQNSRNGHITHYRIEVSTDGTAFTPVVEGYLENDGNSLTDPGKEKEI
KFDTTKAQYVRFIAIESLGDRNNAYASIAELNFYGTTESGEVETVNKAALEAAVTTANAL
KEQGALNNVIPAVVAEFNAALAEAEGILADSNADQVTVDASFFRLATAIQMVDFVKGDKT
ELIKLVEEYSKLEENNYTTASWEVFKGALDAAIAVRDDENALEYEVKEALNNLKDGYAQL
VVVADKTALQAMVDKVNGLDEKLYTEASWAKLADPMAKANEVLANKDATQDEVNAAYEAL
VRAYLELRLIPNKDLLEDLINKAQSFEAANYTADSYANLRSALLVAQSTLANESADEAAV
KAAVEGLQASIDALVPVSADNNVASGDKVNAGDKTAIATGDSTSMLSSIAGLALASIAMF
GAKRRKKSK

Enzyme Prediction     

No EC number prediction in MGYG000001304_00203.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	462	703	6.6e-57	0.5339578454332553
CBM32	1699	1832	5.2e-25	0.9274193548387096
CBM32	994	1120	6.2e-17	0.8951612903225806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06596	GH31_CPE1046	0.0	294	674	1	334	Clostridium CPE1046-like. CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam01055	Glyco_hydro_31	1.30e-60	277	703	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
COG1501	YicI	5.88e-59	56	810	4	772	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd08759	Type_III_cohesin_like	1.27e-41	1205	1369	1	166	Cohesin domain, interaction partner of dockerin. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. Two specific calcium-dependent interactions between cohesin and dockerin appear to be essential for cellulosome assembly, type I and type II. This subfamily represents type III cohesins and closely related domains.
cd06589	GH31	3.30e-40	296	584	1	265	glycosyl hydrolase family 31 (GH31). GH31 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. In most cases, the pyranose moiety recognized in subsite -1 of the substrate binding site is an alpha-D-glucose, though some GH31 family members show a preference for alpha-D-xylose. Several GH31 enzymes can accommodate both glucose and xylose and different levels of discrimination between the two have been observed. Most characterized GH31 enzymes are alpha-glucosidases. In mammals, GH31 members with alpha-glucosidase activity are implicated in at least three distinct biological processes. The lysosomal acid alpha-glucosidase (GAA) is essential for glycogen degradation and a deficiency or malfunction of this enzyme causes glycogen storage disease II, also known as Pompe disease. In the endoplasmic reticulum, alpha-glucosidase II catalyzes the second step in the N-linked oligosaccharide processing pathway that constitutes part of the quality control system for glycoprotein folding and maturation. The intestinal enzymes sucrase-isomaltase (SI) and maltase-glucoamylase (MGAM) play key roles in the final stage of carbohydrate digestion, making alpha-glucosidase inhibitors useful in the treatment of type 2 diabetes. GH31 alpha-glycosidases are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK85989.1	0.0	17	2115	3	2115
QIK69254.1	0.0	54	2061	39	2000
QJA02122.1	0.0	10	2071	1	2112
BBK23937.1	0.0	10	2075	1	2088
QBJ76643.1	0.0	26	2115	12	2070

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M76_A	1.33e-297	45	984	21	963	GH31alpha-N-acetylgalactosaminidase from Enterococcus faecalis [Enterococcus faecalis ATCC 10100],6M77_A GH31 alpha-N-acetylgalactosaminidase from Enterococcus faecalis in complex with N-acetylgalactosamine [Enterococcus faecalis ATCC 10100]
7F7R_A	7.27e-297	45	984	21	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
7F7Q_A	2.01e-296	45	984	21	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
4LKS_A	1.41e-33	1703	1835	33	166	Structureof CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens in complex with galactose [Clostridium perfringens ATCC 13124],4LKS_C Structure of CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens in complex with galactose [Clostridium perfringens ATCC 13124],4LQR_A Structure of CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens ATCC 13124],4P5Y_A Structure of CBM32-3 from a family 31 glycoside hydrolase from Clostridium perfringens in complex with N-acetylgalactosamine [Clostridium perfringens ATCC 13124]
6JR6_A	3.34e-26	62	838	30	821	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	1.72e-32	195	812	144	775	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9FN05	8.28e-25	478	749	566	820	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
B9F676	2.46e-24	478	749	564	818	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
P79403	9.92e-24	469	749	585	851	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1
Q14697	2.25e-23	469	749	585	851	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.241350	0.752216	0.003309	0.001026	0.000705	0.001383

TMHMM  Annotations     

start	end
20	39