CAZyme Information: MGYG000001304_00260

Basic Information

• Species: Erysipelatoclostridium spiroforme
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Erysipelatoclostridium; Erysipelatoclostridium spiroforme
• CAZyme ID: MGYG000001304_00260
• CAZy Family: GT14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289	MGYG000001304_1|CGC7	34515.95	8.3823

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001304	2507485	Isolate	not provided	North America

• Gene Location: Start: 314078; End: 314947 Strand: -

Full Sequence      

MKIAYIILCHKNAKQINMMIDALNDKENIFFIHLDKKSNIENLIKMGSNIHILPEDKRID
IKWGNISMIKATKNLLQAVFNSKEKYDYVWLLSGQDFPLKNQSEIKKYLEENRGKNFIEV
IDQSDLTYNRLLKRNELYYPEWLMKISLFSRVTKIIYMIVTGGLSKTLFLKRKNFLNVKF
YFGSQWWVLTYDCIFDIYSRLDLFSSYYKNCLVPDESIFQTLFMNSNYKDTCEDKLTLVD
WNGQVNHPKTFTINDYDELINSNYLMARKFDENIDDNIIKMLYDNLKNN

Enzyme Prediction     

No EC number prediction in MGYG000001304_00260.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT14	3	250	8.2e-59	0.964

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02485	Branch	5.57e-28	3	262	1	248	Core-2/I-Branching enzyme. This is a family of two different beta-1,6-N-acetylglucosaminyltransferase enzymes, I-branching enzyme and core-2 branching enzyme. I-branching enzyme is responsible for the production of the blood group I-antigen during embryonic development. Core-2 branching enzyme forms crucial side-chain branches in O-glycans. This is a fmmily of glycosyl-transferases that are Type II membrane proteins that are found in the endoplasmic reticulum (ER) and Golgi apparatus.
PLN03183	PLN03183	6.24e-10	22	282	100	364	acetylglucosaminyltransferase family protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY27664.1	2.27e-129	1	287	1	289
BCL58975.1	3.40e-109	2	286	6	288
AEV34326.1	1.99e-53	1	282	1	283
QJS18976.1	3.45e-53	2	282	5	280
ATP00761.1	8.34e-47	1	186	1	188

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EJ7_A	5.17e-11	2	242	119	348	HumanXylosyltransferase 1 in complex with UDP-xylose and peptide QEEEGAGGGQGG [Homo sapiens],6EJ9_A Human Xylosyltransferase 1 in complex with peptide QEPEGSGGGQGG [Homo sapiens],6EJA_A Human Xylosyltransferase 1 in complex with peptide QEEEYSGGGQGG [Homo sapiens],6EJB_A Human Xylosyltransferase 1 in complex with peptide QEEEGSAGGQGG [Homo sapiens],6EJC_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGVGQGG [Homo sapiens],6EJD_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGGPQGG [Homo sapiens],6EJE_A Human Xylosyltransferase 1 in complex with peptide PAAEGSGEQDFT [Homo sapiens],6FOA_A Human Xylosyltransferase 1 apo structure [Homo sapiens]
6EJ8_A	5.17e-11	2	242	123	352	HumanXylosyltransferase 1 in complex with peptide QEEEGSGGGQGG [Homo sapiens]
3OTK_A	2.11e-10	3	287	86	382	Structureand mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_B Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_C Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_D Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus]
2GAK_A	9.18e-10	3	287	86	382	X-raycrystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) [Mus musculus],2GAK_B X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) [Mus musculus],2GAM_A X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus],2GAM_B X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus],2GAM_C X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus],2GAM_D X-ray crystal structure of murine leukocyte-type Core 2 b1,6-N-acetylglucosaminyltransferase (C2GnT-L) in complex with Galb1,3GalNAc [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E9Q649	5.46e-17	3	287	134	430	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Mus musculus OX=10090 GN=Gcnt4 PE=3 SV=1
Q9P109	9.96e-17	3	287	133	429	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=GCNT4 PE=2 SV=1
Q71SG7	1.87e-12	3	137	120	258	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4 OS=Danio rerio OX=7955 GN=gcnt4 PE=2 SV=2
Q9EPI0	8.68e-12	2	282	233	518	Xylosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Xylt2 PE=2 SV=1
Q8N0V5	1.50e-10	3	222	97	304	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Homo sapiens OX=9606 GN=GCNT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001304_00260.